Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal MAP2K3/MKK3 (Ser189) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal TNF Receptor-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Rabbit Polyclonal MKK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKK3 |
Rabbit Polyclonal MKK3 (Ser189) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKK3 around the phosphorylation site of Serine 189 |
| Modifications | Phospho-specific |
Rabbit polyclonal MAP2K3 (Ab-222) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAP2K3 around the phosphorylation site of threonine 222 (A-K-TP-M-D). |
Rabbit polyclonal p53 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 |
Rabbit Polyclonal p53 (Ser15) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 15 |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-DAXX antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 261-274 of human DAXX protein. |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Rabbit anti MKK3 Polyclonal Antibody
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Mouse anti p53 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Families
- Transcription Factors
Pathways
- Amyotrophic lateral sclerosis (ALS)