Products

View as table Download

USD 98.00

USD 390.00

In Stock

POLR1D (Myc-DDK-tagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

USD 98.00

USD 390.00

In Stock

POLR1D (Myc-DDK-tagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, POLR1D (Myc-DDK tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, POLR1D (mGFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

POLR1D (GFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1D (GFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, POLR1D (Myc-DDK tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, POLR1D (mGFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, POLR1D (Myc-DDK tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, POLR1D (mGFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

POLR1D (Myc-DDK tagged) - Homo sapiens polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR1D (GFP-tagged) - Homo sapiens polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-POLR1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

POLR1D (untagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

POLR1D (untagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

POLR1D (untagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

POLR1D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

POLR1D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_057056)

Tag C-Myc/DDK
Expression Host HEK293

POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918)

Tag C-Myc/DDK
Expression Host HEK293

POLR1D (untagged) - Homo sapiens polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 3

Vector pCMV6 series
Tag Tag Free

Transient overexpression of POLR1D (NM_015972) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of POLR1D (NM_152705) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of POLR1D (NM_001206559) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of POLR1D (NM_015972) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of POLR1D (NM_015972) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of POLR1D (NM_152705) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of POLR1D (NM_152705) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of POLR1D (NM_001206559) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack