VPS25 (Myc-DDK-tagged)-Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VPS25 (Myc-DDK-tagged)-Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
VPS25 (GFP-tagged) - Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VPS25 (Myc-DDK tagged) - Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, VPS25 (mGFP-tagged) - Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Goat Polyclonal Antibody against VPS25
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1. |
VPS25 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VPS25 (untagged)-Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-VPS25 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
VPS25 (1-176, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
VPS25 (1-176, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
VPS25 MS Standard C13 and N15-labeled recombinant protein (NP_115729)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-VPS25 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Transient overexpression of VPS25 (NM_032353) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VPS25 (NM_032353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VPS25 (NM_032353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack