USD 420.00
In Stock
PIAS4 (Myc-DDK-tagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
PIAS4 (Myc-DDK-tagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human protein inhibitor of activated STAT, 4 (PIAS4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 460.00
In Stock
PIAS4 (GFP-tagged) - Human protein inhibitor of activated STAT, 4 (PIAS4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human protein inhibitor of activated STAT, 4 (PIAS4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PIAS4 (Myc-DDK tagged) - Human protein inhibitor of activated STAT, 4 (PIAS4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human protein inhibitor of activated STAT, 4 (PIAS4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PIAS4 (mGFP-tagged) - Human protein inhibitor of activated STAT, 4 (PIAS4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PIAS4 (untagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PIAS4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIAS4 Antibody: A synthesized peptide derived from human PIAS4 |
PIAS4 (untagged)-Human protein inhibitor of activated STAT, 4 (PIAS4)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 121.00
In Stock
PIAS4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of protein inhibitor of activated STAT, 4 (PIAS4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-PIAS4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PIAS4. |
Rabbit Polyclonal PIAS4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS4 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human PIAS4. |
Rabbit Polyclonal Anti-PIAS4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIAS4 Antibody: synthetic peptide directed towards the N terminal of human PIAS4. Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK |
USD 2,055.00
3 Weeks
PIAS4 MS Standard C13 and N15-labeled recombinant protein (NP_056981)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of PIAS4 (NM_015897) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIAS4 (NM_015897) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIAS4 (NM_015897) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack