NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NR1H3 (GFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, NR1H3 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, NR1H3 (mGFP-tagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NR1H3 (Myc-DDK tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NR1H3 (Myc-DDK tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NR1H3 (GFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NR1H3 (GFP-tagged) - Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NR1H3 (GFP-tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NR1H3 (GFP-tagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NR1H3 (untagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal NR1H3 Antibody (Center)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3. |
Rabbit anti-NR1H3 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NR1H3 |
LXR alpha (NR1H3) (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | NR1H3 antibody was raised against synthetic peptide - KLH conjugated |
Lenti ORF clone of Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal LXR-A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A. |
NR1H3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Goat Polyclonal Antibody against NR1H3; NR1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CRLQDKKLPPLLSEI, from the internal region of the protein sequence according to NP_005684; NP_009052. |
Rabbit Polyclonal Anti-NR1H3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA |
LXR alpha (NR1H3) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human LXRα, identical to the related rat and mouse sequence. |
Rabbit Polyclonal Antibody against Liver X Receptor
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human LXR protein sequence (between residues 50-150). |
Anti-NR1H3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 50-330 amino acids of human nuclear receptor subfamily 1, group H, member 3 |
Rabbit Polyclonal Anti-NR1H3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
NR1H3 MS Standard C13 and N15-labeled recombinant protein (NP_005684)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
NR1H3 (untagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
NR1H3 (untagged)-Human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
NR1H3 (untagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
NR1H3 (untagged) - Homo sapiens nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR1H3 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |