Germany
Japan
United Kingdom
China
ELL (Myc-DDK-tagged)-Human elongation factor RNA polymerase II (ELL)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ELL (Myc-DDK tagged) - Human elongation factor RNA polymerase II (ELL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ELL (mGFP-tagged) - Human elongation factor RNA polymerase II (ELL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ELL (GFP-tagged) - Human elongation factor RNA polymerase II (ELL)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human elongation factor RNA polymerase II (ELL), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ELL (Myc-DDK tagged) - Human elongation factor RNA polymerase II (ELL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human elongation factor RNA polymerase II (ELL), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ELL (mGFP-tagged) - Human elongation factor RNA polymerase II (ELL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human elongation factor RNA polymerase II (ELL), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human elongation factor RNA polymerase II (ELL), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ELL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELL antibody: synthetic peptide directed towards the N terminal of human ELL. Synthetic peptide located within the following region: GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ |
ELL (untagged)-Human elongation factor RNA polymerase II (ELL)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of elongation factor RNA polymerase II (ELL)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-ELL antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELL. |
ELL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
ELL HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
(untagged)-Homo sapiens, clone MGC:15237 IMAGE:4309802, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal anti-ELL antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELL antibody: synthetic peptide directed towards the C terminal of human ELL. Synthetic peptide located within the following region: TQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHS |
Purified recombinant protein of Human elongation factor RNA polymerase II (ELL), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
ELL (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 523-553aa) of human ELL. |
Rabbit Polyclonal anti-ELL antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELL antibody: synthetic peptide directed towards the middle region of human ELL. Synthetic peptide located within the following region: TDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHAT |
Carrier-free (BSA/glycerol-free) ELL mouse monoclonal antibody,clone OTI3E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELL mouse monoclonal antibody,clone OTI1B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELL mouse monoclonal antibody,clone OTI1H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELL mouse monoclonal antibody,clone OTI4C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELL mouse monoclonal antibody,clone OTI3E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELL mouse monoclonal antibody,clone OTI3E9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELL mouse monoclonal antibody,clone OTI3E9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ELL mouse monoclonal antibody,clone OTI3E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELL mouse monoclonal antibody,clone OTI1B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ELL mouse monoclonal antibody,clone OTI1B5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ELL mouse monoclonal antibody,clone OTI1B5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Active filters
Target Symbol
- ELL
Families
- Transcription Factors