Products

cDNA Clones (50)
Proteins (30)
Antibodies (4)
Jump to Filters
View as table Download
EYA1 (NM_000503) Human Tagged ORF Clone
RC219782

USD 480.00

In Stock

EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EYA1 (NM_172058) Human Tagged ORF Clone
RC221561

USD 480.00

In Stock

EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EYA1 (NM_172059) Human Tagged ORF Clone
RC218031

USD 480.00

In Stock

EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EYA1 (NM_172060) Human Tagged ORF Clone
RC218084

USD 480.00

In Stock

EYA1 (Myc-DDK-tagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EYA1 (NM_172059) Human Tagged ORF Clone Lentiviral Particle
RC218031L1V

USD 880.00

3 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EYA1 (NM_172059) Human Tagged ORF Clone Lentiviral Particle
RC218031L2V

USD 880.00

6 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone Lentiviral Particle
RC218084L1V

USD 880.00

3 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone Lentiviral Particle
RC218084L2V

USD 880.00

6 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone Lentiviral Particle
RC219782L1V

USD 880.00

3 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone Lentiviral Particle
RC219782L2V

USD 880.00

6 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone Lentiviral Particle
RC221561L1V

USD 880.00

3 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone Lentiviral Particle
RC221561L2V

USD 880.00

6 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EYA1 (NM_172059) Human Tagged ORF Clone
RG218031

USD 530.00

In Stock

EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EYA1 (NM_172060) Human Tagged ORF Clone
RG218084

USD 530.00

In Stock

EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EYA1 (NM_172059) Human Tagged ORF Clone
RC218031L3

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172059) Human Tagged ORF Clone Lentiviral Particle
RC218031L3V

USD 880.00

5 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172059) Human Tagged ORF Clone
RC218031L4

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172059) Human Tagged ORF Clone Lentiviral Particle
RC218031L4V

USD 880.00

7 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone
RC218084L3

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone Lentiviral Particle
RC218084L3V

USD 880.00

5 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone
RC218084L4

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone Lentiviral Particle
RC218084L4V

USD 880.00

7 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone
RC219782L3

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone Lentiviral Particle
RC219782L3V

USD 880.00

5 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone
RC219782L4

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone Lentiviral Particle
RC219782L4V

USD 880.00

7 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone
RC221561L3

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone Lentiviral Particle
RC221561L3V

USD 880.00

5 Weeks

Lenti ORF particles, EYA1 (Myc-DDK tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone
RC221561L4

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone Lentiviral Particle
RC221561L4V

USD 880.00

7 Weeks

Lenti ORF particles, EYA1 (mGFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EYA1 (NM_001288575) Human Tagged ORF Clone
RC238420

USD 420.00

2 Weeks

EYA1 (myc-DDK-tagged) - Human EYA transcriptional coactivator and phosphatase 1 (EYA1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EYA1 (NM_001288574) Human Tagged ORF Clone
RC238993

USD 480.00

3 Weeks

EYA1 (myc-DDK-tagged) - Human EYA transcriptional coactivator and phosphatase 1 (EYA1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EYA1 (NM_000503) Human Tagged ORF Clone
RG219782

USD 530.00

3 Weeks

EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EYA1 (NM_172058) Human Tagged ORF Clone
RG221561

USD 530.00

3 Weeks

EYA1 (GFP-tagged) - Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EYA1 (NM_172059) Human Tagged ORF Clone
RC218031L1

USD 840.00

In Stock

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_172060) Human Tagged Lenti ORF Clone
RC218084L1

USD 840.00

In Stock

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone
RC219782L1

USD 840.00

In Stock

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone
RC221561L1

USD 840.00

In Stock

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_000503) Human Untagged Clone
SC309058

USD 760.00

In Stock

EYA1 (untagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
EYA1 Rabbit Polyclonal Antibody
TA346218

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
EYA1 (NM_000503) Human Over-expression Lysate
LY424998

USD 396.00

In Stock

Transient overexpression lysate of eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EYA1 (NM_172059) Human Tagged ORF Clone
RC218031L2

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_172060) Human Tagged ORF Clone
RC218084L2

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_000503) Human Tagged ORF Clone
RC219782L2

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_172058) Human Tagged ORF Clone
RC221561L2

USD 680.00

3 Weeks

Lenti ORF clone of Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EYA1 (NM_172060) Human Untagged Clone
SC109203

USD 950.00

In Stock

EYA1 (untagged)-Human eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
EYA1 (NM_172060) Human Over-expression Lysate
LC430329

USD 121.00

In Stock

EYA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EYA1 (NM_172060) Human Over-expression Lysate
LY430329

USD 396.00

In Stock

Transient overexpression lysate of eyes absent homolog 1 (Drosophila) (EYA1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EYA1 Goat Polyclonal Antibody
TA311588

USD 375.00

5 Days

Goat Anti-EYA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDPTAEYSTIHSP, from the internal region of the protein sequence according to NP_742057.1; NP_000494.2; NP_742056.1.
EYA1 (N-term) Rabbit Polyclonal Antibody
AP51488PU-N

USD 450.00

2 Weeks

EYA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EYA1.