Germany
Japan
United Kingdom
China
NRF1 (Myc-DDK-tagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NRF1 (GFP-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, NRF1 (Myc-DDK tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NRF1 (mGFP-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NRF1 (GFP-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NRF1 (Myc-DDK-tagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nuclear respiratory factor 1 (NRF1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NRF1 (Myc-DDK tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear respiratory factor 1 (NRF1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NRF1 (mGFP-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NRF1 (Myc-DDK-tagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NRF1 (Myc-DDK-tagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NRF1 (mGFP-tagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NRF1 (mGFP-tagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NRF1 (myc-DDK-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NRF1 (myc-DDK-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nuclear respiratory factor 1 (NRF1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
NRF1 (untagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-NRF1 Polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRF1 |
Transient overexpression lysate of nuclear respiratory factor 1 (NRF1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human nuclear respiratory factor 1 (NRF1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NRF1 (untagged)-Human nuclear respiratory factor 1 (NRF1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-NRF1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NRF1. |
NRF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NRF1 Antibody is: synthetic peptide directed towards the middle region of Human NRF1. Synthetic peptide located within the following region: WATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSE |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the C terminal of human NRF1. Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY |
NRF1 (untagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the N terminal of human NRF1. Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED |
Mouse Monoclonal TCF11/NRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NRF1 MS Standard C13 and N15-labeled recombinant protein (NP_001035199)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NRF1 (GFP-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NRF1 (GFP-tagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NRF1 (untagged) - Human nuclear respiratory factor 1 (NRF1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-NRF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NRF1 |
Transient overexpression of NRF1 (NM_001040110) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NRF1 (NM_005011) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NRF1 (NM_001293164) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NRF1 (NM_001293163) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NRF1 (NM_001040110) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NRF1 (NM_001040110) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NRF1 (NM_005011) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NRF1 (NM_001293164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NRF1 (NM_001293163) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NRF1
Families
- Transcription Factors