Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PER3 (GFP-tagged) - Human period homolog 3 (Drosophila) (PER3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of period homolog 3 (Drosophila) (PER3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti-ORF clone of PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PER3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PER3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-PER3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PER3. |
Rabbit Polyclonal Anti-PER3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PER3 Antibody: synthetic peptide directed towards the N terminal of human PER3. Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL |
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PER3 (untagged)-Human period homolog 3 (Drosophila) (PER3)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of PER3 (NM_016831) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289864) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289863) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289861) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289862) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_016831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PER3 (NM_016831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289864) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289863) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack