Products

cDNA Clones (40)
Proteins (13)
RNAi (12)
Antibodies (6)
Gene Expression (6)
Jump to Filters
View as table Download
PER3 (NM_016831) Human Tagged ORF Clone Lentiviral Particle
RC217739L1V

USD 1,730.00

3 Weeks

Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PER3 (NM_016831) Human Tagged ORF Clone Lentiviral Particle
RC217739L2V

USD 1,730.00

6 Weeks

Lenti ORF particles, PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PER3 (NM_016831) Human Tagged ORF Clone
RG217739

USD 1,460.00

In Stock

PER3 (GFP-tagged) - Human period homolog 3 (Drosophila) (PER3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_016831) Human Tagged ORF Clone
RC217739

USD 1,330.00

In Stock

PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Per3 (NM_011067) Mouse Tagged ORF Clone
MR221637

USD 1,030.00

In Stock

Per3 (Myc-DDK-tagged) - Mouse period homolog 3 (Drosophila) (Per3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 Human Gene Knockout Kit (CRISPR)
KN417739

USD 1,290.00

2 Weeks

PER3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN417739 is the updated version of KN217739.
Per3 Mouse Gene Knockout Kit (CRISPR)
KN513108

USD 1,290.00

2 Weeks

Per3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513108 is the updated version of KN313108.
Per3 (NM_011067) Mouse Tagged ORF Clone
MG221637

USD 1,130.00

3 Weeks

Per3 (GFP-tagged) - Mouse period homolog 3 (Drosophila) (Per3), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Per3 (NM_011067) Mouse Tagged ORF Clone
MR221637L3

USD 1,230.00

3 Weeks

Lenti ORF clone of Per3 (Myc-DDK-tagged) - Mouse period homolog 3 (Drosophila) (Per3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_011067) Mouse Tagged ORF Clone Lentiviral Particle
MR221637L3V

USD 1,430.00

6 Weeks

Lenti ORF particles, Per3 (Myc-DDK-tagged) - Mouse period homolog 3 (Drosophila) (Per3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_011067) Mouse Tagged ORF Clone
MR221637L4

USD 1,230.00

3 Weeks

Lenti ORF clone of Per3 (mGFP-tagged) - Mouse period homolog 3 (Drosophila) (Per3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_011067) Mouse Tagged ORF Clone Lentiviral Particle
MR221637L4V

USD 1,430.00

6 Weeks

Lenti ORF particles, Per3 (GFP-tagged) - Mouse period homolog 3 (Drosophila) (Per3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_001289878) Mouse Tagged ORF Clone
MR231176

USD 840.00

4 Weeks

Per3 (myc-DDK-tagged) - Mouse period circadian clock 3 (Per3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Per3 (NM_001289877) Mouse Tagged ORF Clone
MR231591

USD 1,170.00

3 Weeks

Per3 (myc-DDK-tagged) - Mouse period circadian clock 3 (Per3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_016831) Human Tagged ORF Clone
RC217739L3

USD 1,530.00

3 Weeks

Lenti-ORF clone of PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PER3 (NM_016831) Human Tagged ORF Clone Lentiviral Particle
RC217739L3V

USD 1,730.00

11 Weeks

Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PER3 (NM_016831) Human Tagged ORF Clone
RC217739L4

USD 1,530.00

3 Weeks

Lenti-ORF clone of PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PER3 (NM_016831) Human Tagged ORF Clone Lentiviral Particle
RC217739L4V

USD 1,730.00

11 Weeks

Lenti ORF particles, PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PER3 (NM_001289864) Human Tagged ORF Clone
RC239744

USD 750.00

4 Weeks

PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_001289863) Human Tagged ORF Clone
RC240031

USD 1,240.00

5 Weeks

PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_001289861) Human Tagged ORF Clone
RC240035

USD 1,250.00

5 Weeks

PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_001289862) Human Tagged ORF Clone
RC240045

USD 1,270.00

5 Weeks

PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Per3 (NM_023978) Rat Tagged ORF Clone
RR202334

USD 1,880.00

6 Weeks

Per3 (Myc-DDK-tagged ORF) - Rat period homolog 3 (Drosophila) (Per3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Per3 (NM_023978) Rat Tagged ORF Clone
RR202334L3

USD 2,050.00

11 Weeks

Lenti ORF clone of Per3 (Myc-DDK-tagged ORF) - Rat period homolog 3 (Drosophila) (Per3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_023978) Rat Tagged ORF Clone Lentiviral Particle
RR202334L3V

USD 2,270.00

15 Weeks

Lenti ORF particles, Per3 (Myc-DDK-tagged ORF) - Rat period homolog 3 (Drosophila) (Per3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_023978) Rat Tagged ORF Clone
RR202334L4

USD 2,260.00

11 Weeks

Lenti ORF clone of Per3 (mGFP-tagged ORF) - Rat period homolog 3 (Drosophila) (Per3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Per3 (NM_023978) Rat Tagged ORF Clone Lentiviral Particle
RR202334L4V

USD 2,510.00

15 Weeks

Lenti ORF particles, Per3 (GFP-tagged ORF) - Rat period homolog 3 (Drosophila) (Per3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PER3 (NM_016831) Human Tagged Lenti ORF Clone
RC217739L1

USD 1,896.00

In Stock

Lenti-ORF clone of PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PER3 (NM_016831) Human Over-expression Lysate
LY413818

USD 605.00

In Stock

Transient overexpression lysate of period homolog 3 (Drosophila) (PER3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PER3 (NM_016831) Human Tagged ORF Clone
RC217739L2

USD 1,530.00

3 Weeks

Lenti-ORF clone of PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PER3 Human shRNA Plasmid Kit (Locus ID 8863)
TR302544

USD 715.00

In Stock

PER3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
PER3 Rabbit Polyclonal Antibody
AP20426PU-N

USD 407.00

2 Weeks

PER3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PER3 (NM_016831) Human Over-expression Lysate
LC413818

USD 187.00

In Stock

PER3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PER3 Rabbit Polyclonal Antibody
TA314821

USD 345.00

4 Weeks

Rabbit polyclonal anti-PER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PER3.
PER3 Rabbit Polyclonal Antibody
TA335550

USD 375.00

5 Days

Rabbit Polyclonal Anti-PER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PER3 Antibody: synthetic peptide directed towards the N terminal of human PER3. Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL
Human PER3 activation kit by CRISPRa
GA105900

USD 1,290.00

2 Weeks

PER3 CRISPRa kit - CRISPR gene activation of human period circadian regulator 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Per3 activation kit by CRISPRa
GA203178

USD 1,290.00

2 Weeks

Per3 CRISPRa kit - CRISPR gene activation of mouse period circadian clock 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PER3 Human qPCR Primer Pair (NM_016831)
HP212327

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PER3

Per3 (NM_011067) Mouse Untagged Clone
MC223613

USD 1,500.00

6 Weeks

Per3 (untagged) - Mouse period homolog 3 (Drosophila) (Per3), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Per3 (NM_001289878) Mouse Untagged Clone
MC228965

USD 810.00

3 Weeks

Per3 (untagged) - Mouse period circadian clock 3 (Per3), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Per3 (NM_001289877) Mouse Untagged Clone
MC229380

USD 1,120.00

4 Weeks

Per3 (untagged) - Mouse period circadian clock 3 (Per3), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Per3 Mouse qPCR Primer Pair (NM_011067)
MP210719

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Per3

PER3 (NM_001289864) Human Tagged ORF Clone
RG239744

USD 790.00

2 Weeks

PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_001289863) Human Tagged ORF Clone
RG240031

USD 1,280.00

2 Weeks

PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_001289861) Human Tagged ORF Clone
RG240035

USD 1,290.00

2 Weeks

PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PER3 (NM_001289862) Human Tagged ORF Clone
RG240045

USD 1,310.00

2 Weeks

PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Per3 (NM_023978) Rat Untagged Clone
RN202334

USD 1,880.00

7 Weeks

Per3 (untagged ORF) - Rat period homolog 3 (Drosophila) (Per3), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PER3 (NM_016831) Human Untagged Clone
SC309952

USD 2,430.00

3 Weeks

PER3 (untagged)-Human period homolog 3 (Drosophila) (PER3)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PER3 (NM_001289864) Human Untagged Clone
SC337638

USD 900.00

4 Weeks

PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PER3 (NM_001289863) Human Untagged Clone
SC337925

USD 1,210.00

5 Weeks

PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin