Products

View as table Download

RORB (GFP-tagged) - Human RAR-related orphan receptor B (RORB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human RAR-related orphan receptor B (RORB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

RORB (untagged)-Human RAR-related orphan receptor B (RORB)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-RORB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK

RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat, Sheep
Immunogen RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%).

Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

RORB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of RAR-related orphan receptor B (RORB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB MS Standard C13 and N15-labeled recombinant protein (NP_008845)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-RORB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORB

RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of RORB (NM_006914) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of RORB (NM_006914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack