Germany
Japan
United Kingdom
China
TAF13 (Myc-DDK-tagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, TAF13 (Myc-DDK tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TAF13 (mGFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TAF13 (GFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF13 (Myc-DDK tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF13 (mGFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TAF13 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-TAF13 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF13. |
Transient overexpression lysate of TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-TAF13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF13 antibody: synthetic peptide directed towards the N terminal of human TAF13. Synthetic peptide located within the following region: ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYT |
TAF13 MS Standard C13 and N15-labeled recombinant protein (NP_005636)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
(untagged)-Homo sapiens, TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18 kD, clone MGC:22425 IMAGE:4289451, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TAF13 (untagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of TAF13 (NM_005645) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAF13 (NM_005645) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAF13 (NM_005645) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TAF13
Families
- Transcription Factors