Products

cDNA Clones (31)
Proteins (17)
Antibodies (8)
Jump to Filters
View as table Download
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L2V

USD 1,020.00

In Stock

Lenti ORF particles, TFEB (mGFP-tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, TFEB (mGFP-tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_007162) Human Tagged ORF Clone
RG207153

USD 460.00

In Stock

TFEB (GFP-tagged) - Human transcription factor EB (TFEB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Tagged ORF Clone
RC207153

USD 420.00

In Stock

TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Untagged Clone
SC122773

USD 310.00

In Stock

TFEB (untagged)-Human transcription factor EB (TFEB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TFEB (NM_007162) Human Recombinant Protein
TP760282

USD 215.00

In Stock

Recombinant protein of human transcription factor EB (TFEB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L1V

USD 820.00

6 Weeks

Lenti ORF particles, TFEB (Myc-DDK tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L1V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L2V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone
RG230141

USD 460.00

In Stock

TFEB (GFP-tagged) - Human transcription factor EB (TFEB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001167827) Human Tagged ORF Clone
RC230141

USD 420.00

In Stock

TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271944) Human Tagged ORF Clone
RC234213

USD 420.00

In Stock

TFEB (Myc-DDK tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271945) Human Tagged ORF Clone
RC234214

USD 420.00

In Stock

TFEB (Myc-DDK tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001167827) Human Tagged ORF Clone
RC230141L4

USD 620.00

In Stock

Lenti-ORF clone of TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001271944) Human Tagged ORF Clone
RG234213

USD 460.00

2 Weeks

TFEB (GFP-tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L3V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (Myc-DDK tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L3V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L4V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001271943) Human Tagged ORF Clone
RC233963

USD 420.00

5 Weeks

TFEB (Myc-DDK tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271943) Human Tagged ORF Clone
RG233963

USD 460.00

5 Weeks

TFEB (GFP-tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271945) Human Tagged ORF Clone
RG234214

USD 460.00

3 Weeks

TFEB (GFP-tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Tagged Lenti ORF Clone
RC207153L2

USD 768.00

In Stock

Lenti ORF clone of Human transcription factor EB (TFEB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFEB (NM_001167827) Human Tagged Lenti ORF Clone
RC230141L2

USD 768.00

In Stock

Lenti-ORF clone of TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFEB Rabbit Polyclonal Antibody
TA344452

USD 475.00

5 Days

Rabbit Polyclonal Anti-TFEB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
TFEB (NM_001167827) Human Tagged Lenti ORF Clone
RC230141L1

USD 768.00

In Stock

Lenti-ORF clone of TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TFEB (NM_007162) Human Tagged ORF Clone
RC207153L3

USD 768.00

In Stock

Lenti ORF clone of Human transcription factor EB (TFEB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_007162) Human Over-expression Lysate
LY416167

USD 396.00

In Stock

Transient overexpression lysate of transcription factor EB (TFEB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TFEB (NM_007162) Human Over-expression Lysate
LC416167

USD 121.00

2 Weeks

TFEB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TFEB Goat Polyclonal Antibody
TA305749

USD 375.00

In Stock

Goat Anti-TFEB (internal) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKDLQKSRELENH, from the internal region of the protein sequence according to NP_009093.1.
TFEB Rabbit Polyclonal Antibody
TA319741

USD 430.00

5 Days

Rabbit Polyclonal TFEB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TFEB antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human TFEB.
TFEB Rabbit Polyclonal Antibody
TA343618

USD 410.00

5 Days

Rabbit Polyclonal Anti-TFEB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the C terminal of human TFEB. Synthetic peptide located within the following region: SLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
TFEB (NM_007162) Human Tagged ORF Clone
RC207153L1

USD 620.00

3 Weeks

Lenti ORF clone of Human transcription factor EB (TFEB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TFEB Rabbit Polyclonal Antibody
TA325931

USD 345.00

4 Weeks

Rabbit Polyclonal TFEB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TFEB
TFEB (NM_001167827) Human Untagged Clone
SC328779

USD 760.00

5 Days

TFEB (untagged)-Human transcription factor EB (TFEB) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TFEB Rabbit Polyclonal Antibody
TA326618

USD 430.00

5 Days

Rabbit Polyclonal TFEB Antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit polyclonal TFEB antibody was raised against a 16 amino acid peptide near the carboxy terminus of human TFEB.
TFEB Rabbit Polyclonal Antibody
TA308593

USD 415.00

5 Days

Rabbit polyclonal antibody to TFEB (transcription factor EB)

Applications WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of TFEB (Uniprot ID#P19484)
TFEB Rabbit Polyclonal Antibody
TA330079

USD 375.00

5 Days

Rabbit Polyclonal Anti-TFEB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR
TFEB (NM_001271943) Human Untagged Clone
SC333159

USD 390.00

5 Weeks

TFEB (untagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 5

Vector pCMV6 series
Tag Tag Free
TFEB (NM_001271944) Human Untagged Clone
SC333160

USD 480.00

5 Weeks

TFEB (untagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 3

Vector pCMV6 series
Tag Tag Free
TFEB (NM_001271945) Human Untagged Clone
SC333161

USD 480.00

5 Weeks

TFEB (untagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 4

Vector pCMV6 series
Tag Tag Free
TFEB (NM_007162) ICC Control Block
TB407153

USD 1,070.00

4 Weeks

Transient overexpression of TFEB (NM_007162) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TFEB (NM_001167827) ICC Control Block
TB430141

USD 1,070.00

4 Weeks

Transient overexpression of TFEB (NM_001167827) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TFEB (NM_001271943) ICC Control Block
TB433963

USD 1,070.00

4 Weeks

Transient overexpression of TFEB (NM_001271943) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TFEB (NM_001271944) ICC Control Block
TB434213

USD 1,070.00

4 Weeks

Transient overexpression of TFEB (NM_001271944) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TFEB (NM_001271945) ICC Control Block
TB434214

USD 1,070.00

4 Weeks

Transient overexpression of TFEB (NM_001271945) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TFEB Cytosection
TS407153

USD 225.00

4 Weeks

Transient overexpression of TFEB (NM_007162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TFEB Cytosection
TS407153P5

USD 889.00

4 Weeks

Transient overexpression of TFEB (NM_007162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TFEB Cytosection
TS430141

USD 225.00

4 Weeks

Transient overexpression of TFEB (NM_001167827) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack