USD 820.00
3 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ABCD3 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ABCD3 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCD3 (GFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCD3 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
6 Weeks
Lenti ORF particles, ABCD3 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, ABCD3 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ABCD3 (GFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Monoclonal antibody against PMP70
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-ABCD3 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCD3. |
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ABCD3 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ABCD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD |
Goat Anti-ABCD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1. |
ABCD3 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of ABCD3 (NM_002858) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCD3 (NM_001122674) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, Ile440-End, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of ABCD3 (NM_002858) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCD3 (NM_002858) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCD3 (NM_001122674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCD3 (NM_001122674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack