Germany
Japan
United Kingdom
China
TNFRSF9 (untagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadTNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
In Stock
Lenti ORF particles, TNFRSF9 (mGFP-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TNFRSF9 (GFP-tagged) - Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, TNFRSF9 (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9).
| Tag | Tag Free |
| Expression Host | E. coli |
USD 1,020.00
3 Weeks
Lenti ORF particles, TNFRSF9 (mGFP-tagged)-Human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-TNFRSF9 Antibody
| Applications | WB |
| Reactivities | Canine, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Purified recombinant protein of human tumor necrosis factor receptor superfamily, member 9 (TNFRSF9), with C-terminal DDK/His tag, expressed in human cells, 20 µg
| Tag | C-DDK/His |
| Expression Host | HEK293 |
CD137 / TNFRSF9 (18-186, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD137 / TNFRSF9 (18-186, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD137 / TNFRSF9 (18-186, hIgG-His-tagged) human protein, 0.25 mg
| Tag | hIgG-His-tag |
| Expression Host | Insect |
CD137 / TNFRSF9 (18-186, hIgG-His-tagged) human protein, 50 µg
| Tag | hIgG-His-tag |
| Expression Host | Insect |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI2B11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 5H5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 5H5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 7F9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 7F9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TNFRSF9 mouse monoclonal antibody,clone OTI2B11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFRSF9 mouse monoclonal antibody,clone OTI2B11, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFRSF9 mouse monoclonal antibody,clone OTI2B11, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
Active filters
Target Symbol
- TNFRSF9
Families
- Transmembrane
Pathways
- Cytokine-cytokine receptor interaction