Germany
Japan
United Kingdom
China
CLDN4 (Myc-DDK-tagged)-Human claudin 4 (CLDN4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human claudin 4 (CLDN4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CLDN4 (GFP-tagged) - Human claudin 4 (CLDN4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,020.00
2 Weeks
Lenti ORF particles, CLDN4 (Myc-DDK tagged) - Human claudin 4 (CLDN4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,020.00
2 Weeks
Lenti ORF particles, CLDN4 (mGFP-tagged) - Human claudin 4 (CLDN4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF clone of Human claudin 4 (CLDN4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human claudin 4 (CLDN4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,020.00
2 Weeks
Lenti ORF particles, CLDN4 (mGFP-tagged) - Human claudin 4 (CLDN4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,020.00
2 Weeks
Lenti ORF particles, CLDN4 (Myc-DDK tagged) - Human claudin 4 (CLDN4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CLDN4 (untagged)-Human claudin 4 (CLDN4)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human claudin 4 (CLDN4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of claudin 4 (CLDN4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CLDN4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-Claudin 4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 4 Antibody: A synthesized peptide derived from human Claudin 4 |
Claudin 4 (CLDN4) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 177~206 amino acids from the C-terminal region of human CLDN4 |
Rabbit Polyclonal Anti-CLDN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN4 antibody is: synthetic peptide directed towards the C-terminal region of Human CLDN4. Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS |
Rabbit anti Claudin 4 Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
CLDN4 MS Standard C13 and N15-labeled recombinant protein (NP_001296)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-CLDN4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4 |
Transient overexpression of CLDN4 (NM_001305) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLDN4 (NM_001305) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN4 (NM_001305) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CLDN4
Families
- Transmembrane
Pathways
- Leukocyte transendothelial migration