Germany
Japan
United Kingdom
China
ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABCG5 (GFP-tagged) - Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ABCG5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
ABCG5 (untagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Anti-ABCG5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-30 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 5 |
Transient overexpression of ABCG5 (NM_022436) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCG5 (NM_022436) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCG5 (NM_022436) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ABCG5
Families
- Transmembrane