Germany
Japan
United Kingdom
China
ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Abcg5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCG5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN418776 is the updated version of KN218776.
Abcg5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500643 is the updated version of KN300643.
Abcg5 (GFP-tagged) - Mouse ATP-binding cassette sub-family G (WHITE) member 5 (Abcg5), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcg5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcg5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcg5 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcg5 (GFP-tagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABCG5 (GFP-tagged) - Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Abcg5 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcg5 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcg5 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcg5 (mGFP-tagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcg5 (GFP-tagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ABCG5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ABCG5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
ABCG5 (untagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ABCG5 (mGFP-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene ABCG5
ABCG5 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily G member 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abcg5 CRISPRa kit - CRISPR gene activation of mouse ATP binding cassette subfamily G member 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abcg5 (untagged) - Mouse ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Abcg5
Abcg5 (untagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 5 (Abcg5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of ATP-binding cassette sub-family G (WHITE) member 5 (ABCG5) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ABCG5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Abcg5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Abcg5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ABCG5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-30 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 5 |
ABCG5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ABCG5 (NP_071881.1). |
| Modifications | Unmodified |
Transient overexpression of ABCG5 (NM_022436) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ABCG5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ABCG5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Abcg5 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Abcg5 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Abcg5 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Abcg5 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
ABCG5 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Abcg5 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Abcg5 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of ABCG5 (NM_022436) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCG5 (NM_022436) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ABCG5