Germany
Japan
United Kingdom
China
ADAM19 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 19 (ADAM19)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ADAM19 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ADAM19 (mGFP-tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ADAM19 (GFP-tagged) - Human ADAM metallopeptidase domain 19 (ADAM19)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM19 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM19 (mGFP-tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ADAM19 (untagged)-Human ADAM metallopeptidase domain 19 (ADAM19)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of ADAM metallopeptidase domain 19 (meltrin beta) (ADAM19)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ADAM19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM19 antibody: synthetic peptide directed towards the N terminal of human ADAM19. Synthetic peptide located within the following region: GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET |
Rabbit Polyclonal Anti-ADAM19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM19 antibody: synthetic peptide directed towards the N terminal of human ADAM19. Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG |
Rabbit polyclonal anti-ADAM19 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM19 |
ADAM19 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of ADAM19 (NM_033274) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADAM19 (NM_033274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADAM19 (NM_033274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ADAM19
Families
- Transmembrane