ADAM19 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 19 (ADAM19)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM19 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 19 (ADAM19)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ADAM19 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ADAM19 (mGFP-tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ADAM19 (GFP-tagged) - Human ADAM metallopeptidase domain 19 (ADAM19)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Adam19 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM19 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Adam19 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Adam19 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Adam19 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Adam19 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Adam19 (mGFP-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Adam19 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Adam19 (myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Adam19 (myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM19 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM19 (mGFP-tagged) - Human ADAM metallopeptidase domain 19 (ADAM19), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Adam19 (myc-DDK-tagged) - Rat ADAM metallopeptidase domain 19 (Adam19)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM19 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADAM19 |
Adam19 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ADAM19 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ADAM19 (untagged)-Human ADAM metallopeptidase domain 19 (ADAM19)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADAM19 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 207-236 amino acids from the Central region of Human ADAM19. |
Lenti ORF clone of Human ADAM metallopeptidase domain 19 (ADAM19), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Anti-ADAM19 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KIQCQSSEARPLESN, from the internal region of the protein sequence according to NP_150377.1. |
Transient overexpression lysate of ADAM metallopeptidase domain 19 (meltrin beta) (ADAM19)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ADAM19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM19 antibody: synthetic peptide directed towards the N terminal of human ADAM19. Synthetic peptide located within the following region: GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET |
Rabbit Polyclonal Anti-ADAM19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM19 antibody: synthetic peptide directed towards the N terminal of human ADAM19. Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG |
Rabbit polyclonal anti-ADAM19 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ADAM19 |
ADAM19 CRISPRa kit - CRISPR gene activation of human ADAM metallopeptidase domain 19
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Adam19 CRISPRa kit - CRISPR gene activation of mouse a disintegrin and metallopeptidase domain 19 (meltrin beta)
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ADAM19
ADAM19 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Adam19 (untagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Adam19 (untagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Adam19 (untagged) - Mouse a disintegrin and metallopeptidase domain 19 (meltrin beta) (Adam19), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Adam19
Adam19 (untagged) - Rat ADAM metallopeptidase domain 19 (Adam19)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ADAM19 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADAM19 |
ADAM19 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 203-460 of human ADAM19 (NP_150377.1). |
Modifications | Unmodified |
Transient overexpression of ADAM19 (NM_033274) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ADAM19 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
ADAM19 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Adam19 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Adam19 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
ADAM19 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Adam19 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of ADAM19 (NM_033274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack