ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM2 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM2 (mGFP-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM2 (mGFP-tagged)-Human ADAM metallopeptidase domain 2 (ADAM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM2 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM2 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Anti-ADAM2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase domain 2 |
ADAM2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ADAM2 (untagged)-Human ADAM metallopeptidase domain 2 (ADAM2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of ADAM metallopeptidase domain 2 (ADAM2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ADAM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADAM2 Antibody: synthetic peptide directed towards the middle region of human ADAM2. Synthetic peptide located within the following region: PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL |
ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM2 (GFP-tagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM2 (untagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ADAM2 (untagged) - Human ADAM metallopeptidase domain 2 (ADAM2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-ADAM2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase domain 2 |
ADAM2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADAM2 (NM_001278114) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADAM2 (NM_001278113) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADAM2 (NM_001464) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADAM2 (NM_001278114) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADAM2 (NM_001278113) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack