Germany
Japan
United Kingdom
China
USD 98.00
USD 560.00
In Stock
ANGPTL7 (Myc-DDK-tagged)-Human angiopoietin-like 7 (ANGPTL7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,020.00
2 Weeks
Lenti ORF particles, ANGPTL7 (Myc-DDK tagged) - Human angiopoietin-like 7 (ANGPTL7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,020.00
5 Weeks
Lenti ORF particles, ANGPTL7 (mGFP-tagged) - Human angiopoietin-like 7 (ANGPTL7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Recombinant protein of human angiopoietin-like 7 (ANGPTL7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ANGPTL7 (GFP-tagged) - Human angiopoietin-like 7 (ANGPTL7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 768.00
3 Weeks
Lenti ORF clone of Human angiopoietin-like 7 (ANGPTL7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,020.00
5 Weeks
Lenti ORF particles, ANGPTL7 (Myc-DDK tagged) - Human angiopoietin-like 7 (ANGPTL7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 768.00
3 Weeks
Lenti ORF clone of Human angiopoietin-like 7 (ANGPTL7), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,020.00
5 Weeks
Lenti ORF particles, ANGPTL7 (mGFP-tagged) - Human angiopoietin-like 7 (ANGPTL7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ANGPTL7 (untagged)-Human angiopoietin-like 7 (ANGPTL7)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of angiopoietin-like 7 (ANGPTL7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Angiopoietin like 7 (ANGPTL7) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ANGPTL7 |
USD 768.00
In Stock
Lenti ORF clone of Human angiopoietin-like 7 (ANGPTL7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
USD 768.00
3 Weeks
Lenti ORF clone of Human angiopoietin-like 7 (ANGPTL7), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ANGPTL7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-ANGPTL7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ANGPTL7. |
Rabbit Polyclonal Anti-ANGPTL7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANGPTL7 antibody: synthetic peptide directed towards the middle region of human ANGPTL7. Synthetic peptide located within the following region: NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP |
ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of ANGPTL7 (NM_021146) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANGPTL7 (NM_021146) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ANGPTL7 (NM_021146) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ANGPTL7
Families
- Transmembrane