ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP2A1 (Myc-DDK tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP2A1 (mGFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP2A1 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A1 (mGFP-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ATP2A1 (mGFP-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A1 (myc-DDK-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Transient overexpression lysate of ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ATP2A1 (522-613) mouse monoclonal antibody, clone 1B11, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATP2A1 |
ATP2A1 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant a
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-ATP2A1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP2A1. |
ATP2A1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ATP2A1 MS Standard C13 and N15-labeled recombinant protein (NP_775293)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ATP2A1 (GFP-tagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A1 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant b
Vector | pCMV6 series |
Tag | Tag Free |
ATP2A1 (untagged) - Human ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 (ATP2A1), transcript variant c
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of ATP2A1 (NM_173201) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP2A1 (NM_004320) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP2A1 (NM_001286075) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP2A1 (NM_173201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP2A1 (NM_173201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATP2A1 (NM_004320) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ATP2A1 (NM_001286075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack