Products

cDNA Clones (22)
Proteins (11)
Antibodies (2)
Jump to Filters
View as table Download
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RC203440

USD 98.00

USD 390.00

In Stock

ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RG203440

USD 460.00

In Stock

ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RC203440L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone Lentiviral Particle
RC203440L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (Myc-DDK tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RC203440L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone Lentiviral Particle
RC203440L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (mGFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RC213998

USD 420.00

3 Weeks

ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RC213998L3

USD 620.00

3 Weeks

Lenti-ORF clone of ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone Lentiviral Particle
RC213998L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RC213998L4

USD 620.00

3 Weeks

Lenti-ORF clone of ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone Lentiviral Particle
RC213998L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RC229723

USD 420.00

3 Weeks

ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RC229723L3

USD 620.00

8 Weeks

Lenti-ORF clone of ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone Lentiviral Particle
RC229723L3V

USD 820.00

11 Weeks

Lenti ORF particles, ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RC229723L4

USD 620.00

8 Weeks

Lenti-ORF clone of ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone Lentiviral Particle
RC229723L4V

USD 820.00

11 Weeks

Lenti ORF particles, ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RG213998

USD 460.00

4 Weeks

ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RG229723

USD 460.00

3 Weeks

ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_080592) Human Untagged Clone
SC110444

USD 660.00

In Stock

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
C2orf28 (ATRAID) (NM_016085) Human Recombinant Protein
TP761376

USD 215.00

In Stock

Purified recombinant protein of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
C2orf28 (ATRAID) (NM_016085) Human Untagged Clone
SC114444

USD 310.00

In Stock

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
C2orf28 (ATRAID) (NM_016085) Human Untagged Clone
SC320990

USD 310.00

In Stock

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
C2orf28 (ATRAID) Rabbit Polyclonal Antibody
TA329155

USD 375.00

5 Days

Rabbit Polyclonal anti-C2orf28 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
C2orf28 (ATRAID) (NM_016085) Human Over-expression Lysate
LC414191

USD 121.00

2 Weeks

ATRAID HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
C2orf28 (ATRAID) (NM_001170795) Human Untagged Clone
SC328361

USD 420.00

3 Weeks

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
C2orf28 (ATRAID) Rabbit Polyclonal Antibody
TA355839

USD 360.00

5 Days

C2orf28 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
C2orf28 (ATRAID) (NM_016085) ICC Control Block
TB403440

USD 1,040.00

4 Weeks

Transient overexpression of ATRAID (NM_016085) in HEK293T cells paraffin embedded controls for ICC/IHC staining

C2orf28 (ATRAID) (NM_080592) ICC Control Block
TB413998

USD 1,070.00

4 Weeks

Transient overexpression of ATRAID (NM_080592) in HEK293T cells paraffin embedded controls for ICC/IHC staining

C2orf28 (ATRAID) (NM_001170795) ICC Control Block
TB429723

USD 1,070.00

4 Weeks

Transient overexpression of ATRAID (NM_001170795) in HEK293T cells paraffin embedded controls for ICC/IHC staining

C2orf28 (ATRAID) Cytosection
TS403440

USD 225.00

4 Weeks

Transient overexpression of ATRAID (NM_016085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

C2orf28 (ATRAID) Cytosection
TS403440P5

USD 889.00

4 Weeks

Transient overexpression of ATRAID (NM_016085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

C2orf28 (ATRAID) ICC Control Sections
TS413998P5

USD 889.00

4 Weeks

Transient overexpression of ATRAID (NM_080592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

C2orf28 (ATRAID) Cytosection
TS429723

USD 225.00

10 Weeks

Transient overexpression of ATRAID (NM_001170795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

C2orf28 (ATRAID) Cytosection
TS429723P5

USD 889.00

4 Weeks

Transient overexpression of ATRAID (NM_001170795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack