Products

cDNA Clones (38)
Proteins (11)
RNAi (11)
Gene Expression (9)
Antibodies (2)
Jump to Filters
View as table Download
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RC203440

USD 98.00

USD 390.00

In Stock

ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Atraid (NM_027855) Mouse Tagged ORF Clone
MR202579

USD 68.00

USD 149.00

In Stock

Atraid (Myc-DDK-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RG203440

USD 460.00

In Stock

ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) Human Gene Knockout Kit (CRISPR)
KN403440

USD 1,290.00

2 Weeks

ATRAID - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403440 is the updated version of KN203440.
Atraid (NM_027855) Mouse Tagged ORF Clone
MG202579

USD 300.00

3 Weeks

Atraid (GFP-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atraid (NM_027855) Mouse Tagged ORF Clone
MR202579L3

USD 500.00

3 Weeks

Lenti ORF clone of Atraid (Myc-DDK-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atraid (NM_027855) Mouse Tagged ORF Clone Lentiviral Particle
MR202579L3V

USD 700.00

6 Weeks

Lenti ORF particles, Atraid (Myc-DDK-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atraid (NM_027855) Mouse Tagged ORF Clone
MR202579L4

USD 500.00

3 Weeks

Lenti ORF clone of Atraid (mGFP-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atraid (NM_027855) Mouse Tagged ORF Clone Lentiviral Particle
MR202579L4V

USD 700.00

6 Weeks

Lenti ORF particles, Atraid (GFP-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RC203440L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone Lentiviral Particle
RC203440L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (Myc-DDK tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone
RC203440L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_016085) Human Tagged ORF Clone Lentiviral Particle
RC203440L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (mGFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RC213998

USD 420.00

3 Weeks

ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RC213998L3

USD 620.00

3 Weeks

Lenti-ORF clone of ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone Lentiviral Particle
RC213998L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RC213998L4

USD 620.00

3 Weeks

Lenti-ORF clone of ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone Lentiviral Particle
RC213998L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RC229723

USD 420.00

3 Weeks

ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RC229723L3

USD 620.00

8 Weeks

Lenti-ORF clone of ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone Lentiviral Particle
RC229723L3V

USD 820.00

11 Weeks

Lenti ORF particles, ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RC229723L4

USD 620.00

8 Weeks

Lenti-ORF clone of ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone Lentiviral Particle
RC229723L4V

USD 820.00

11 Weeks

Lenti ORF particles, ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Tagged ORF Clone
RG213998

USD 460.00

4 Weeks

ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C2orf28 (ATRAID) (NM_001170795) Human Tagged ORF Clone
RG229723

USD 460.00

3 Weeks

ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atraid (NM_001127526) Rat Tagged ORF Clone
RR207972

USD 420.00

4 Weeks

Atraid (Myc-DDK-tagged ORF) - Rat similar to apoptosis related protein APR-3, p18 protein (RGD1311605), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Atraid (NM_001127526) Rat Tagged ORF Clone
RR207972L3

USD 640.00

8 Weeks

Lenti ORF clone of Atraid (Myc-DDK-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atraid (NM_001127526) Rat Tagged ORF Clone Lentiviral Particle
RR207972L3V

USD 850.00

12 Weeks

Lenti ORF particles, Atraid (Myc-DDK-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atraid (NM_001127526) Rat Tagged ORF Clone
RR207972L4

USD 700.00

8 Weeks

Lenti ORF clone of Atraid (mGFP-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atraid (NM_001127526) Rat Tagged ORF Clone Lentiviral Particle
RR207972L4V

USD 960.00

12 Weeks

Lenti ORF particles, Atraid (GFP-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C2orf28 (ATRAID) (NM_080592) Human Untagged Clone
SC110444

USD 660.00

In Stock

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
C2orf28 (ATRAID) (NM_016085) Human Recombinant Protein
TP761376

USD 215.00

In Stock

Purified recombinant protein of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Atraid (NM_027855) Mouse Untagged Clone
MC202506

USD 210.00

In Stock

Atraid (untagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Atraid (NM_212470) Mouse Untagged Clone
MC205026

USD 210.00

In Stock

0610007C21Rik (untagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 2, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
C2orf28 (ATRAID) (NM_016085) Human Untagged Clone
SC114444

USD 310.00

In Stock

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
C2orf28 (ATRAID) (NM_016085) Human Untagged Clone
SC320990

USD 310.00

In Stock

ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
C2orf28 (ATRAID) Human shRNA Plasmid Kit (Locus ID 51374)
TR305888

USD 715.00

In Stock

ATRAID - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
C2orf28 (ATRAID) Rabbit Polyclonal Antibody
TA329155

USD 375.00

5 Days

Rabbit Polyclonal anti-C2orf28 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Human C2orf28 (ATRAID) activation kit by CRISPRa
GA109773

USD 1,290.00

2 Weeks

ATRAID CRISPRa kit - CRISPR gene activation of human all-trans retinoic acid induced differentiation factor

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Atraid activation kit by CRISPRa
GA217145

USD 1,290.00

2 Weeks

Atraid CRISPRa kit - CRISPR gene activation of mouse all-trans retinoic acid induced differentiation factor

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ATRAID Human qPCR Template Standard (NM_016085)
HK201433

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene C2orf28

Application Plasmid of exact quantity for transcript copy number calculation
ATRAID Human qPCR Template Standard (NM_080592)
HK211573

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene C2orf28

Application Plasmid of exact quantity for transcript copy number calculation
C2orf28 (ATRAID) Human qPCR Primer Pair (NM_080592)
HP225579

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ATRAID

C2orf28 (ATRAID) (NM_016085) Human Over-expression Lysate
LC414191

USD 121.00

2 Weeks

ATRAID HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
C2orf28 (ATRAID) (NM_016085) Human Over-expression Lysate
LY414191

USD 396.00

5 Days

Transient overexpression lysate of chromosome 2 open reading frame 28 (C2orf28), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Atraid Mouse qPCR Template Standard (NM_027855)
MK201995

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene 0610007C21Rik

Application Plasmid of exact quantity for transcript copy number calculation
Atraid Mouse qPCR Template Standard (NM_212470)
MK204217

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene 0610007C21Rik

Application Plasmid of exact quantity for transcript copy number calculation
Atraid Mouse qPCR Primer Pair (NM_027855)
MP212954

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Atraid

Atraid (NM_001127526) Rat Untagged Clone
RN207972

USD 420.00

4 Weeks

Atraid (untagged ORF) - Rat similar to apoptosis related protein APR-3, p18 protein (RGD1311605), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
C2orf28 (ATRAID) (NM_080592) Human 3' UTR Clone
SC203077

USD 560.00

4 Weeks

3`UTR clone of chromosome 2 open reading frame 28 (C2orf28) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase