ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Atraid (Myc-DDK-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATRAID - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Atraid (GFP-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Atraid (Myc-DDK-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Atraid (Myc-DDK-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Atraid (mGFP-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Atraid (GFP-tagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ATRAID (Myc-DDK tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ATRAID (mGFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, ATRAID (Myc-DDK-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, ATRAID (mGFP-tagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATRAID (GFP-tagged) - Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Atraid (Myc-DDK-tagged ORF) - Rat similar to apoptosis related protein APR-3, p18 protein (RGD1311605), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Atraid (Myc-DDK-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Atraid (Myc-DDK-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Atraid (mGFP-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Atraid (GFP-tagged ORF) - Rat similar to apoptosis related protein APR-3; p18 protein (RGD1311605), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Atraid (untagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 1, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
0610007C21Rik (untagged) - Mouse RIKEN cDNA 0610007C21 gene (0610007C21Rik), transcript variant 2, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ATRAID (untagged)-Human chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ATRAID - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Rabbit Polyclonal anti-C2orf28 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS |
ATRAID CRISPRa kit - CRISPR gene activation of human all-trans retinoic acid induced differentiation factor
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Atraid CRISPRa kit - CRISPR gene activation of mouse all-trans retinoic acid induced differentiation factor
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene C2orf28
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene C2orf28
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ATRAID
ATRAID HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene 0610007C21Rik
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene 0610007C21Rik
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Atraid
Atraid (untagged ORF) - Rat similar to apoptosis related protein APR-3, p18 protein (RGD1311605), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of chromosome 2 open reading frame 28 (C2orf28) transcript variant 2 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |