Products

View as table Download

CLCN1 (Myc-DDK-tagged)-Human chloride channel 1, skeletal muscle (CLCN1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CLCN1 (Myc-DDK tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CLCN1 (mGFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CLCN1 (Myc-DDK tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CLCN1 (mGFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CLCN1 (GFP-tagged) - Human chloride channel 1, skeletal muscle (CLCN1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CLCN1 (untagged)-Human chloride channel 1, skeletal muscle (CLCN1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit anti-CLCN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLCN1

Lenti ORF clone of Human chloride channel 1, skeletal muscle (CLCN1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CLCN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-Clcn1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV

USD 1,070.00

4 Weeks

Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CLCN1 (NM_000083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack