Products

cDNA Clones (12)
Proteins (6)
Antibodies (4)
Jump to Filters
View as table Download
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RC205927

USD 420.00

In Stock

DNASE1 (Myc-DDK-tagged)-Human deoxyribonuclease I (DNASE1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RG205927

USD 460.00

In Stock

DNASE1 (GFP-tagged) - Human deoxyribonuclease I (DNASE1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RC205927L4

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyribonuclease I (DNASE1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DNase I (DNASE1) (1-252) Rabbit Polyclonal Antibody
AP23615PU-N

USD 440.00

2 Weeks

DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I.
DNase I (DNASE1) (NM_005223) Human Untagged Clone
SC116856

USD 310.00

In Stock

DNASE1 (untagged)-Human deoxyribonuclease I (DNASE1)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
DNase I (DNASE1) (NM_005223) Human Over-expression Lysate
LY401601

USD 396.00

In Stock

Transient overexpression lysate of deoxyribonuclease I (DNASE1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA308546

USD 415.00

In Stock

Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855)
DNase I (DNASE1) (NM_005223) Human Untagged Clone
SC324542

USD 310.00

In Stock

DNASE1 (untagged)-Human deoxyribonuclease I (DNASE1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DNase I (DNASE1) (NM_005223) Human Recombinant Protein
TP761147

USD 215.00

In Stock

Purified recombinant protein of Human deoxyribonuclease I (DNASE1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
DNase I (DNASE1) (NM_005223) Human Tagged ORF Clone
RC205927L2

USD 620.00

3 Weeks

Lenti ORF clone of Human deoxyribonuclease I (DNASE1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DNase I (DNASE1) (NM_005223) Human Over-expression Lysate
LC401601

USD 121.00

In Stock

DNASE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA339005

USD 375.00

5 Days

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
DNase I (DNASE1) Rabbit Polyclonal Antibody
TA349900

USD 345.00

In Stock

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1
DNase I (DNASE1) ICC Control Block
TB405927

USD 1,070.00

4 Weeks

Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DNase I (DNASE1) Cytosection
TS405927

USD 225.00

4 Weeks

Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DNase I (DNASE1) Cytosection
TS405927P5

USD 889.00

4 Weeks

Transient overexpression of DNASE1 (NM_005223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack