EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,150.00
3 Weeks
Lenti ORF particles, EPHA3 (mGFP-tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,150.00
In Stock
Lenti ORF particles, EPHA3 (Myc-DDK tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
EPHA3 (GFP-tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
EPHA3 (GFP-tagged) - Human EPH receptor A3 (EPHA3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPHA3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor A3, transcript variant 1, Signal peptide (1-20) plus EC domain (21-541)
Vector | pCMV6-XL5-DDK-His |
Tag | DDK-His |
Mammalian Cell Selection | None |
EPHA3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor A3, transcript variant 2, Signal peptide (1-20) plus EC domain (21-539)
Vector | pCMV6-XL5-DDK-His |
Tag | DDK-His |
Mammalian Cell Selection | None |
Lenti ORF clone of Human EPH receptor A3 (EPHA3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
7 Weeks
Lenti ORF particles, EPHA3 (Myc-DDK tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human EPH receptor A3 (EPHA3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
3 Weeks
Lenti ORF particles, EPHA3 (mGFP-tagged) - Human EPH receptor A3 (EPHA3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, EPHA3 (Myc-DDK-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EPHA3 (mGFP-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, EPHA3 (mGFP-tagged)-Human EPH receptor A3 (EPHA3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EPHA3 (untagged)-Human EPH receptor A3 (EPHA3), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal EPHA3 (Ab-602) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPHA3. |
Rabbit Polyclonal Anti-EPHA3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3 |
Transient overexpression lysate of EPH receptor A3 (EPHA3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-EPHA3 antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA3. |
Rabbit Polyclonal Anti-EPHA3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EPHA3 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA3. Synthetic peptide located within the following region: SVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYT |
Purified recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg
Tag | C-DDK/His |
Expression Host | HEK293 |
EPHA3 (untagged)-Kinase deficient mutant (K653M) of Human EPH receptor A3 (EPHA3), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal EPHA3/4/5 (Tyr779/833) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPHA3/4/5 around the phosphorylation site of tyrosine 779 (A-A-YP-T-T). |
Modifications | Phospho-specific |
EPHA3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 1, residues 21-541aa, with C-terminal DDK tag, expressed in sf9, 20ug
Tag | C-DDK |
Expression Host | Sf9 |
EPHA3 MS Standard C13 and N15-labeled recombinant protein (NP_005224)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
EPHA3 (untagged)-Human EPH receptor A3 (EPHA3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal anti-EPHA3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EPHA3 |
Rabbit Polyclonal anti-EPHA3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EPHA3 |
Transient overexpression of EPHA3 (NM_005233) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPHA3 (NM_182644) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of human EPH receptor A3 (EPHA3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg
Tag | C-DDK/His |
Expression Host | HEK293 |
Transient overexpression of EPHA3 (NM_005233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPHA3 (NM_005233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of EPHA3 (NM_182644) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPHA3 (NM_182644) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack