GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GJB1 (GFP-tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GJB1 (mGFP-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GJB1 (mGFP-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GJB1 (Myc-DDK tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GJB1 (mGFP-tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GJB1 (GFP-tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GJB1 (untagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
GJB1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 81-130 of Human Connexin 32. |
Rabbit Polyclonal Anti-Connexin 32 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Transient overexpression lysate of gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GJB1 mouse monoclonal antibody, clone CXN-32, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
GJB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-GJB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR |
Rabbit Polyclonal Anti-GJB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Transient overexpression lysate of gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Mouse monoclonal Anti-Cx32 Clone Connexin32
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
GJB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GJB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GJB1 (untagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GJB1 (NM_000166) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GJB1 (NM_001097642) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GJB1 (NM_000166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GJB1 (NM_000166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GJB1 (NM_001097642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GJB1 (NM_001097642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack