Products

View as table Download

GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GJB1 (GFP-tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJB1 (Myc-DDK-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GJB1 (mGFP-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJB1 (mGFP-tagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJB1 (Myc-DDK tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GJB1 (mGFP-tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GJB1 (GFP-tagged) - Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GJB1 (untagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

GJB1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 81-130 of Human Connexin 32.

Rabbit Polyclonal Anti-Connexin 32 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32

GJB1 mouse monoclonal antibody, clone CXN-32, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

GJB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Transient overexpression lysate of gap junction protein, beta 1, 32kDa (GJB1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY424887 is the same product as LY424986.

Mouse monoclonal Anti-Cx32 Clone Connexin32

Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated

GJB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GJB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GJB1 (untagged)-Human gap junction protein, beta 1, 32kDa (GJB1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,070.00

4 Weeks

Transient overexpression of GJB1 (NM_000166) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of GJB1 (NM_001097642) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GJB1 (NM_000166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GJB1 (NM_000166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of GJB1 (NM_001097642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GJB1 (NM_001097642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack