Products

View as table Download

Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GPR176 (GFP-tagged) - Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

GPR176 (Myc-DDK tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (GFP-tagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GPR176 (untagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti-ORF clone of GPR176 (Myc-DDK-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of GPR176 (mGFP-tagged)-Human G protein-coupled receptor 176 (GPR176)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-GPR176 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR176 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR176. Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 2

Vector pCMV6 series
Tag Tag Free

GPR176 (untagged) - Homo sapiens G protein-coupled receptor 176 (GPR176), transcript variant 3

Vector pCMV6 series
Tag Tag Free

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GPR176 (NM_007223) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of GPR176 (NM_001271855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of GPR176 (NM_001271854) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack