Products

View as table Download

USD 98.00

USD 390.00

In Stock

LTC4S (Myc-DDK-tagged)-Human leukotriene C4 synthase (LTC4S)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human leukotriene C4 synthase (LTC4S)

Tag C-Myc/DDK
Expression Host HEK293T

LTC4S (GFP-tagged) - Human leukotriene C4 synthase (LTC4S)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human leukotriene C4 synthase (LTC4S), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human leukotriene C4 synthase (LTC4S), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

LTC4S (untagged)-Human leukotriene C4 synthase (LTC4S)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

LTC4S (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human LTC4S

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

LTC4S HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874)

Tag C-Myc/DDK
Expression Host HEK293

USD 1,040.00

4 Weeks

Transient overexpression of LTC4S (NM_145867) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of LTC4S (NM_145867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of LTC4S (NM_145867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack