LTC4S (Myc-DDK-tagged)-Human leukotriene C4 synthase (LTC4S)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LTC4S (Myc-DDK-tagged)-Human leukotriene C4 synthase (LTC4S)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human leukotriene C4 synthase (LTC4S)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
LTC4S (GFP-tagged) - Human leukotriene C4 synthase (LTC4S)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human leukotriene C4 synthase (LTC4S), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LTC4S (Myc-DDK tagged) - Human leukotriene C4 synthase (LTC4S), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human leukotriene C4 synthase (LTC4S), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LTC4S (mGFP-tagged) - Human leukotriene C4 synthase (LTC4S), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LTC4S (untagged)-Human leukotriene C4 synthase (LTC4S)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of leukotriene C4 synthase (LTC4S)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal Anti-LTC4S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
LTC4S (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human LTC4S |
Rabbit polyclonal Anti-LTC4S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
LTC4S HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of LTC4S (NM_145867) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LTC4S (NM_145867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LTC4S (NM_145867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack