Products

cDNA Clones (48)
Proteins (22)
Antibodies (10)
Jump to Filters
View as table Download
CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone
RC224768

USD 880.00

In Stock

CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MIA2 (NM_054024) Human Tagged ORF Clone Lentiviral Particle
RC224284L1V

USD 820.00

3 Weeks

Lenti ORF particles, MIA2 (Myc-DDK tagged) - Human melanoma inhibitory activity 2 (MIA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MIA2 (NM_054024) Human Tagged ORF Clone Lentiviral Particle
RC224284L2V

USD 820.00

6 Weeks

Lenti ORF particles, MIA2 (mGFP-tagged) - Human melanoma inhibitory activity 2 (MIA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CTAGE5 (MIA2) (NM_005930) Human Tagged ORF Clone
RC221265

USD 890.00

In Stock

CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MIA2 (NM_054024) Human Tagged ORF Clone
RC224284

USD 420.00

In Stock

MIA2 (Myc-DDK-tagged)-Human melanoma inhibitory activity 2 (MIA2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MIA2 (NM_054024) Human Tagged ORF Clone
RG224284

USD 460.00

In Stock

MIA2 (GFP-tagged) - Human melanoma inhibitory activity 2 (MIA2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone
RC218068

USD 610.00

4 Weeks

CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone
RC218068L3

USD 810.00

4 Weeks

Lenti-ORF clone of CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone Lentiviral Particle
RC218068L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone
RC218068L4

USD 810.00

4 Weeks

Lenti-ORF clone of CTAGE5 (mGFP-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_005930) Human Tagged ORF Clone
RC221265L3

USD 1,090.00

3 Weeks

Lenti-ORF clone of CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_005930) Human Tagged ORF Clone Lentiviral Particle
RC221265L3V

USD 1,290.00

6 Weeks

Lenti ORF particles, CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_005930) Human Tagged ORF Clone
RC221265L4

USD 1,090.00

3 Weeks

Lenti-ORF clone of CTAGE5 (mGFP-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203355) Human Tagged ORF Clone
RC221348

USD 850.00

4 Weeks

CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_203355) Human Tagged ORF Clone
RC221348L3

USD 1,050.00

4 Weeks

Lenti-ORF clone of CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203355) Human Tagged ORF Clone Lentiviral Particle
RC221348L3V

USD 1,250.00

7 Weeks

Lenti ORF particles, CTAGE5 (Myc-DDK-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203355) Human Tagged ORF Clone
RC221348L4

USD 1,050.00

4 Weeks

Lenti-ORF clone of CTAGE5 (mGFP-tagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_054024) Human Tagged ORF Clone
RC224284L3

USD 620.00

3 Weeks

Lenti ORF clone of Human melanoma inhibitory activity 2 (MIA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MIA2 (NM_054024) Human Tagged ORF Clone Lentiviral Particle
RC224284L3V

USD 820.00

5 Weeks

Lenti ORF particles, MIA2 (Myc-DDK tagged) - Human melanoma inhibitory activity 2 (MIA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_054024) Human Tagged ORF Clone
RC224284L4

USD 620.00

3 Weeks

Lenti ORF clone of Human melanoma inhibitory activity 2 (MIA2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MIA2 (NM_054024) Human Tagged ORF Clone Lentiviral Particle
RC224284L4V

USD 820.00

7 Weeks

Lenti ORF particles, MIA2 (mGFP-tagged) - Human melanoma inhibitory activity 2 (MIA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone
RC224768L3

USD 1,080.00

3 Weeks

Lenti ORF clone of Human CTAGE family, member 5 (CTAGE5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone Lentiviral Particle
RC224768L3V

USD 1,280.00

6 Weeks

Lenti ORF particles, CTAGE5 (Myc-DDK tagged) - Human CTAGE family, member 5 (CTAGE5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone
RC224768L4

USD 1,080.00

3 Weeks

Lenti ORF clone of Human CTAGE family, member 5 (CTAGE5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTAGE5 (MIA2) (NM_001247990) Human Tagged ORF Clone
RC234787

USD 770.00

5 Weeks

CTAGE5 (Myc-DDK tagged) - Homo sapiens CTAGE family, member 5 (CTAGE5), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_001247988) Human Tagged ORF Clone
RC234791

USD 610.00

5 Weeks

CTAGE5 (Myc-DDK tagged) - Homo sapiens CTAGE family, member 5 (CTAGE5), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_001247989) Human Tagged ORF Clone
RC234913

USD 610.00

5 Weeks

CTAGE5 (Myc-DDK tagged) - Homo sapiens CTAGE family, member 5 (CTAGE5), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_203356) Human Tagged ORF Clone
RG218068

USD 670.00

5 Weeks

CTAGE5 (GFP-tagged) - Human CTAGE family, member 5 (CTAGE5), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_005930) Human Tagged ORF Clone
RG221265

USD 980.00

3 Weeks

CTAGE5 (GFP-tagged) - Human CTAGE family, member 5 (CTAGE5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_203355) Human Tagged ORF Clone
RG221348

USD 940.00

5 Weeks

CTAGE5 (GFP-tagged) - Human CTAGE family, member 5 (CTAGE5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_203354) Human Tagged ORF Clone
RG224768

USD 970.00

3 Weeks

CTAGE5 (GFP-tagged) - Human CTAGE family, member 5 (CTAGE5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_001247990) Human Tagged ORF Clone
RG234787

USD 850.00

5 Weeks

CTAGE5 (GFP-tagged) - Homo sapiens CTAGE family, member 5 (CTAGE5), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_001247988) Human Tagged ORF Clone
RG234791

USD 670.00

5 Weeks

CTAGE5 (GFP-tagged) - Homo sapiens CTAGE family, member 5 (CTAGE5), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTAGE5 (MIA2) (NM_001247989) Human Tagged ORF Clone
RG234913

USD 670.00

5 Weeks

CTAGE5 (GFP-tagged) - Homo sapiens CTAGE family, member 5 (CTAGE5), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MIA2 (NM_054024) Human Tagged Lenti ORF Clone
RC224284L1

USD 768.00

In Stock

Lenti ORF clone of Human melanoma inhibitory activity 2 (MIA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CTAGE5 (MIA2) Rabbit Polyclonal Antibody
TA345939

USD 475.00

5 Days

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: LLEGPLRLSPLLPGGGGRGSRGPGNPLDHQITNERGESSCDRLTDPHRAP
CTAGE5 (MIA2) Rabbit Polyclonal Antibody
TA345940

USD 475.00

5 Days

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the N terminal of human CTAGE5. Synthetic peptide located within the following region: DEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKM
CTAGE5 (MIA2) Rabbit Polyclonal Antibody
TA346486

USD 475.00

5 Days

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: PPRGFPPYLPPRPGFFPPPPHSEGRSEFPSGLIPPSNEPATEHPEPQQET
CTAGE5 (MIA2) Rabbit Polyclonal Antibody
TA346487

USD 475.00

5 Days

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: KLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHD
CTAGE5 (MIA2) (NM_054024) Human Tagged ORF Clone
RC224284L2

USD 620.00

3 Weeks

Lenti ORF clone of Human melanoma inhibitory activity 2 (MIA2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CTAGE5 (MIA2) (NM_005930) Human Untagged Clone
SC108811

USD 1,630.00

In Stock

CTAGE5 (untagged)-Human CTAGE family, member 5 (CTAGE5), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MIA2 Rabbit Polyclonal Antibody
TA316029

USD 345.00

In Stock

Rabbit polyclonal anti-MIA2 antibody

Applications WB
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MIA2.
MIA2 Rabbit Polyclonal Antibody
TA328384

USD 285.00

5 Days

Anti-Human MIA-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Immunogen E.coli derived Recombinant Human MIA-2
CTAGE5 (MIA2) (C-term) Rabbit Polyclonal Antibody
AP51114PU-N

USD 512.00

2 Weeks

CTAGE5 (MIA2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 774-804 amino acids from the C-terminal region of human CTAGE5
MIA2 Rabbit Polyclonal Antibody
TA328383

USD 285.00

5 Days

Biotinylated Anti-Human MIA-2 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human MIA-2
MIA2 Rabbit Polyclonal Antibody
TA343046

USD 375.00

5 Days

Rabbit Polyclonal Anti-MIA2 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-MIA2 antibody: synthetic peptide directed towards the C terminal of human MIA2. Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT