Products

cDNA Clones (10)
Proteins (5)
Antibodies (3)
Jump to Filters
View as table Download
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone
RC204038

USD 450.00

In Stock

MUL1 (Myc-DDK-tagged)-Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone
RG204038

USD 500.00

In Stock

MUL1 (GFP-tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone Lentiviral Particle
RC204038L1V

USD 850.00

3 Weeks

Lenti ORF particles, MUL1 (Myc-DDK tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone Lentiviral Particle
RC204038L2V

USD 850.00

6 Weeks

Lenti ORF particles, MUL1 (mGFP-tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone Lentiviral Particle
RC204038L3V

USD 850.00

5 Weeks

Lenti ORF particles, MUL1 (Myc-DDK tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone Lentiviral Particle
RC204038L4V

USD 850.00

3 Weeks

Lenti ORF particles, MUL1 (mGFP-tagged) - Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Untagged Clone
SC112170

USD 310.00

In Stock

MUL1 (untagged)-Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Untagged Clone
SC321149

USD 310.00

In Stock

MUL1 (untagged)-Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone
RC204038L1

USD 650.00

In Stock

Lenti ORF clone of Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Tagged ORF Clone
RC204038L2

USD 650.00

3 Weeks

Lenti ORF clone of Human mitochondrial E3 ubiquitin protein ligase 1 (MUL1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) Human Over-expression Lysate
LY411243

USD 396.00

5 Days

Transient overexpression lysate of mitochondrial E3 ubiquitin ligase 1 (MUL1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

E3 ubiquitin protein ligase MUL1 (MUL1) (C-term) Rabbit Polyclonal Antibody
AP52776PU-N

USD 512.00

2 Weeks

E3 ubiquitin protein ligase MUL1 (MUL1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 272-301 aa) of human MUL1 / RNF218
E3 ubiquitin protein ligase MUL1 (MUL1) Rabbit Polyclonal Antibody
TA330465

USD 375.00

5 Days

Rabbit Polyclonal Anti-MUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
E3 ubiquitin protein ligase MUL1 (MUL1) Rabbit Polyclonal Antibody
TA330466

USD 375.00

5 Days

Rabbit Polyclonal Anti-MUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
E3 ubiquitin protein ligase MUL1 (MUL1) (NM_024544) ICC Control Block
TB404038

USD 1,100.00

4 Weeks

Transient overexpression of MUL1 (NM_024544) in HEK293T cells paraffin embedded controls for ICC/IHC staining

E3 ubiquitin protein ligase MUL1 (MUL1) Cytosection
TS404038

USD 225.00

4 Weeks

Transient overexpression of MUL1 (NM_024544) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

E3 ubiquitin protein ligase MUL1 (MUL1) Cytosection
TS404038P5

USD 889.00

4 Weeks

Transient overexpression of MUL1 (NM_024544) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack