PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLP1 (Myc-DDK-tagged)-Human proteolipid protein 1 (PLP1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLP1 (GFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLP1 (GFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLP1 (Myc-DDK tagged) - Human proteolipid protein 1 (PLP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLP1 (mGFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLP1 (Myc-DDK tagged) - Human proteolipid protein 1 (PLP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLP1 (mGFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLP1 (Myc-DDK tagged) - Human proteolipid protein 1 (PLP1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteolipid protein 1 (PLP1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLP1 (mGFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLP1 (GFP-tagged) - Human proteolipid protein 1 (PLP1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLP1 (untagged)-Human proteolipid protein 1 (PLP1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PLP1 chicken polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide KLH conjugated corresponding to a sequence shared between the Mouse (P60202) and Human (NP_000524) gene products. Production: After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. The concentrations of the eluates were then adjusted to 0.1 mg/ml, and the preparation was filter-sterilized. |
PLP1 (untagged)-Human proteolipid protein 1 (PLP1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of proteolipid protein 1 (PLP1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of proteolipid protein 1 (PLP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PLP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the N terminal of human PLP1. Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
Rabbit Polyclonal Anti-PLP1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ |
Transient overexpression lysate of proteolipid protein 1 (PLP1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PLP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLP1 (untagged)-Human proteolipid protein 1 (PLP1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of PLP1 (NM_000533) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLP1 (NM_199478) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLP1 (NM_001128834) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLP1 (NM_000533) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLP1 (NM_000533) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLP1 (NM_199478) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLP1 (NM_199478) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLP1 (NM_001128834) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLP1 (NM_001128834) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack