SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCN3B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
SCN3B (GFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCN3B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCN3B (mGFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SCN3B (GFP-tagged) - Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SCN3B (untagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Anti-SCN3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND |
Rabbit Polyclonal SCN3B Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
SCN3B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SCN3B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SCN3B (untagged)-Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SCN3B (23-159, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
SCN3B (23-159, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
SCN3B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Lenti ORF clone of Human sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SCN3B (NM_001040151) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SCN3B (NM_018400) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack