Germany
Japan
United Kingdom
China
TSHR (Myc-DDK-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,010.00
6 Weeks
Lenti ORF particles, TSHR (mGFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TSHR (GFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TSHR (Myc-DDK-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TSHR (Myc-DDK-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TSHR (Myc-DDK-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, TSHR (Myc-DDK-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TSHR (mGFP-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, TSHR (mGFP-tagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,010.00
5 Weeks
Lenti ORF particles, TSHR (Myc-DDK tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
3 Weeks
Lenti ORF particles, TSHR (mGFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human thyroid stimulating hormone receptor (TSHR), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, TSHR (Myc-DDK tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human thyroid stimulating hormone receptor (TSHR), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, TSHR (mGFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TSHR (GFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TSHR (GFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS |
Transient overexpression lysate of thyroid stimulating hormone receptor (TSHR), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
TSHR (untagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
USD 1,248.00
3 Weeks
Lenti ORF particles, TSHR (Myc-DDK tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: ELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM |
TSHR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
TSHR (untagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TSHR (untagged)-Human thyroid stimulating hormone receptor (TSHR), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat Anti-TSHR (aa101-115) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKVTHIEIRNTRNLT, from the internal region of the protein sequence according to NP_000360.2; NP_001018046.1. |
Rabbit Polyclonal Anti-TSHR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TSH Receptor / TSHR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human TSH Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bat, Dog, Elephant, Horse, Pig, Guinea pig (94%); Mouse, Rat, Sheep, Cat, Bovine, Hamster, Panda, Rabbit, Opossum (89%). |
Rabbit Polyclonal Anti-TSHR Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TSH Receptor / TSHR antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human TSH Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey (95%); Bovine, Panda, Pig (90%); Sheep, Elephant, Horse (85%); Marmoset, Dog, Rabbit (80%). |
TSHR MS Standard C13 and N15-labeled recombinant protein (NP_001136098)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-TSHR Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-253 amino acids of human thyroid stimulating hormone receptor |
Transient overexpression of TSHR (NM_001018036) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TSHR (NM_000369) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TSHR (NM_001142626) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, Met22-Gly413, with C-terminal Human FC-AVI plus and His tag, expressed in CHO cells, 50ug
| Tag | C-HUMAN |
| Expression Host | CHO |
Transient overexpression of TSHR (NM_001018036) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TSHR (NM_000369) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TSHR (NM_000369) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TSHR (NM_001142626) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TSHR (NM_001142626) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TSHR
Families
- Transmembrane