Products

View as table Download

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Rabbit Polyclonal Anti-CSNK1G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G3 antibody: synthetic peptide directed towards the middle region of human CSNK1G3. Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Rabbit Polyclonal Anti-CSNK1A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD

Rabbit Polyclonal Anti-WNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

Rabbit polyclonal Anti-PRKX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Rabbit Polyclonal Anti-DHH Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL

Rabbit anti Glycogen Synthase Kinase 3b (GSK3b) Polyclonal Antibody

Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti GSK3b(Paired S9) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -TTSFA- without phosphorylation of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species

Rabbit anti GSK3b(pS9) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -TTSFA- with a phosphorylation site at Ser9 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species.

Rabbit anti GSK-3b (pY216) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -NVSYI- with a phosphorylation site at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species.

Rabbit anti GSK-3b (Paired Y216) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -NVSYI- without phosphorylation at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species

Rabbit anti GSK-3b Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of GSK-3beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species.

Anti-WNT9A Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A

Anti-SMO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor

Anti-LRP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 4640-4054 amino acids of Human low density lipoprotein receptor-related protein 2

Anti-LRP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 4642-4654 amino acids of Human low density lipoprotein receptor-related protein 2

Anti-PRKACG Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma

Anti-PRKACG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma

Anti-GSK3B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 396-408 amino acids of Human glycogen synthase kinase 3 beta

Anti-CSNK1A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 316-329 amino acids of Human Casein kinase I isoform alpha

Anti-BMP4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog

Anti-GSK3B (Phospho-Tyr216) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 216 (V-S-Y(p)-I-C) derived from Human GSK3β.
Modifications Phospho-specific

Rabbit Polyclonal Anti-WNT11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT11

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D

Rabbit Polyclonal Anti-IHH Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IHH

Rabbit Polyclonal Anti-PRKX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKX

Rabbit Polyclonal Anti-WNT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

Rabbit Polyclonal Anti-DHH Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DHH

Rabbit Polyclonal Anti-GAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAS1

Rabbit Polyclonal Anti-STK36 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK36

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2B

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Rabbit Polyclonal Anti-WNT6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT6

Rabbit Polyclonal Anti-WNT8A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT8A

Rabbit Polyclonal Anti-WNT8B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT8B

Rabbit Polyclonal Anti-WNT10A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT10A

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT10B

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2