Germany
Japan
United Kingdom
China
Lenti ORF particles, PDE4D (mGFP-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table DownloadPDE4D (Myc-DDK-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PDE4D (Myc-DDK-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDE4D (Myc-DDK-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PDE4D (mGFP-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDE4D (mGFP-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PDE4D (GFP-tagged) - Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDE4D (GFP-tagged) - Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDE4D (GFP-tagged) - Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDE4D (GFP-tagged) - Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDE4D (GFP-tagged) - Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) (PDE4D), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti-ORF clone of PDE4D (Myc-DDK-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 3
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of PDE4D (Myc-DDK-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 7
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-PDE4D Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDE4D |
PDE4D (untagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310179 is the updated version of SC104585.
Rabbit Polyclonal Anti-PDE4D Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE4D antibody is: synthetic peptide directed towards the C-terminal region of Human PDE4D. Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ |
Rabbit Polyclonal Anti-PDE4D Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pde4d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ |
Lenti ORF clone of Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of PDE4D (mGFP-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 3
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of PDE4D (mGFP-tagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 7
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against PDE4D3
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HVNNFPFRRHS-C, from the N Terminus of the protein sequence according to AAA97892.1. |
Rabbit Polyclonal antibody to PDE4D (phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 746 and 809 of PDE4D (Uniprot ID#Q08499) |
PDE4D HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PDE4D HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDE4D HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 8
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 6
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDE4D MS Standard C13 and N15-labeled recombinant protein (NP_006194)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PDE4D (untagged)-Human phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
PDE4D (untagged)-Human phosphodiesterase 4D cAMP-specific (phosphodiesterase E3 dunce homolog Drosophila) (PDE4D) transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PDE4D Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PDE4D |
Transient overexpression of PDE4D (NM_006203) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001104631) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001165899) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001197223) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001197221) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001197222) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001197220) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001197219) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_001197218) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE4D (NM_006203) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDE4D (NM_006203) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDE4D (NM_001104631) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDE4D (NM_001104631) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDE4D (NM_001165899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- PDE4D
Pathways
- Purine metabolism