Germany
Japan
United Kingdom
China
CAMK2B (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadCAMK2B (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAMK2B (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAMK2B (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287 |
| Modifications | Phospho-specific |
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E). |
| Modifications | Phospho-specific |
Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 6
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CAMK2B (untagged)-Kinase deficient mutant (K43M) of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal CaMK2-beta/gamma/delta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK2-beta/gamma/delta |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 6
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 7
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 8
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CAMK2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK2B antibody: synthetic peptide directed towards the C terminal of human CAMK2B. Synthetic peptide located within the following region: NPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV |
Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5
| Tag | C-His |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) CAMK2B mouse monoclonal antibody, clone OTI10G2 (formerly 10G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAMK2B mouse monoclonal antibody,clone OTI4G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAMK2B mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CAMK2B MS Standard C13 and N15-labeled recombinant protein (NP_742078)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CAMK2B (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CAMK2B (untagged)-Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CAMK2B (untagged) - Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 9
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-CAMK2B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 14-272 amino acids of human Calcium/calmodulin-dependent protein kinase type II subunit beta |
Active filters
Target Symbol
- CAMK2B
Pathways
- Wnt signaling pathway