Germany
Japan
United Kingdom
China
Lenti ORF particles, Hk1 (Myc-DDK-tagged ORF) - Rat hexokinase 1 (Hk1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table DownloadLenti ORF clone of Hk1 (mGFP-tagged ORF) - Rat hexokinase 1 (Hk1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hk1 (GFP-tagged ORF) - Rat hexokinase 1 (Hk1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HK1 (untagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
Hexokinase-1 (1-917, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Hexokinase-1 (1-917, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-Hexokinase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Hexokinase 1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Hexokinase 1. |
Lenti ORF clone of Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Hk1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
HK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
HK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Homo sapiens gene HK1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HK1 antibody: synthetic peptide directed towards the middle region of human HK1. Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HK1 antibody: synthetic peptide directed towards the N terminal of human HK1. Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV |
Mouse Monoclonal Hexokinase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HK1 CRISPRa kit - CRISPR gene activation of human hexokinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Hk1 CRISPRa kit - CRISPR gene activation of mouse hexokinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HK1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Hk1 (untagged) - Mouse hexokinase 1 (Hk1), nuclear gene encoding mitochondrial protein, transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Hk1 (untagged) - Mouse hexokinase 1 (Hk1), nuclear gene encoding mitochondrial protein, transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Hk1
HK1 MS Standard C13 and N15-labeled recombinant protein (NP_000179)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Hk1 (untagged ORF) - Rat hexokinase 1 (Hk1), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of hexokinase 1 (HK1) nuclear gene encoding mitochondrial protein transcript variant 4 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of hexokinase 1 (HK1) nuclear gene encoding mitochondrial protein transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of hexokinase 1 (HK1) nuclear gene encoding mitochondrial protein transcript variant 5 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of hexokinase 1 (HK1) nuclear gene encoding mitochondrial protein transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of hexokinase 1 (HK1) nuclear gene encoding mitochondrial protein transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
HK1 (untagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
HK1 (untagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
HK1 (untagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HK1 (untagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
HK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320470 is the updated version of SR302108.
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HK1 |
HK1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HK1 |
HK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HK1 |
Transient overexpression of HK1 (NM_000188) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HK1 (NM_033500) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HK1 (NM_033497) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HK1 (NM_033498) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HK1 (NM_033496) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HK1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
HK1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- HK1