Products

cDNA Clones (81)
Proteins (33)
Antibodies (32)
RNAi (14)
Gene Expression (13)
Jump to Filters
View as table Download
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RC217862

USD 420.00

2 Weeks

MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RC217862L3

USD 620.00

6 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone Lentiviral Particle
RC217862L3V

USD 820.00

9 Weeks

Lenti ORF particles, MAPK9 (Myc-DDK tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RC217862L4

USD 620.00

6 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone Lentiviral Particle
RC217862L4V

USD 820.00

9 Weeks

Lenti ORF particles, MAPK9 (mGFP-tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RC225304

USD 420.00

3 Weeks

MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RC225304L3

USD 620.00

8 Weeks

Lenti-ORF clone of MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone Lentiviral Particle
RC225304L3V

USD 820.00

11 Weeks

Lenti ORF particles, MAPK9 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RC225304L4

USD 620.00

8 Weeks

Lenti-ORF clone of MAPK9 (mGFP-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone Lentiviral Particle
RC225304L4V

USD 820.00

11 Weeks

Lenti ORF particles, MAPK9 (mGFP-tagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JNK2 (MAPK9) (NM_139069) Human Tagged ORF Clone
RG217862

USD 460.00

3 Weeks

MAPK9 (GFP-tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_001135044) Human Tagged ORF Clone
RG225304

USD 460.00

3 Weeks

MAPK9 (GFP-tagged) - Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-g

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mapk9 (NM_017322) Rat Tagged ORF Clone
RR204589

USD 420.00

4 Weeks

Mapk9 (Myc-DDK-tagged ORF) - Rat mitogen-activated protein kinase 9 (Mapk9), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mapk9 (NM_017322) Rat Tagged ORF Clone
RR204589L3

USD 640.00

8 Weeks

Lenti ORF clone of Mapk9 (Myc-DDK-tagged ORF) - Rat mitogen-activated protein kinase 9 (Mapk9), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mapk9 (NM_017322) Rat Tagged ORF Clone Lentiviral Particle
RR204589L3V

USD 850.00

12 Weeks

Lenti ORF particles, Mapk9 (Myc-DDK-tagged ORF) - Rat mitogen-activated protein kinase 9 (Mapk9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mapk9 (NM_017322) Rat Tagged ORF Clone
RR204589L4

USD 700.00

8 Weeks

Lenti ORF clone of Mapk9 (mGFP-tagged ORF) - Rat mitogen-activated protein kinase 9 (Mapk9), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mapk9 (NM_017322) Rat Tagged ORF Clone Lentiviral Particle
RR204589L4V

USD 960.00

12 Weeks

Lenti ORF particles, Mapk9 (GFP-tagged ORF) - Rat mitogen-activated protein kinase 9 (Mapk9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mapk9 (NM_001270545) Rat Tagged ORF Clone
RR216529

USD 420.00

3 Weeks

Mapk9 (myc-DDK-tagged) - Rat mitogen-activated protein kinase 9 (Mapk9), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
JNK2 (MAPK9) (NM_139068) Human Tagged ORF Clone
RC207608L1

USD 768.00

In Stock

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
JNK2 (MAPK9) (NM_002752) Human Tagged ORF Clone
RC212814L1

USD 768.00

In Stock

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
JNK2 (MAPK9) (NM_002752) Human Untagged Clone
SC111675

USD 310.00

In Stock

MAPK9 (untagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
JNK2 (MAPK9) Human qPCR Primer Pair (NM_002752)
HP206385

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene MAPK9

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
MAPK9 Human shRNA Plasmid Kit (Locus ID 5601)
TG320486

USD 715.00

In Stock

MAPK9 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin
Mapk9 Mouse shRNA Plasmid (Locus ID 26420)
TR502601

USD 715.00

2 Weeks

Mapk9 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
JNK2 (MAPK9) (NM_002752) Human Untagged Clone
SC323575

USD 760.00

In Stock

MAPK9 (untagged)-Kinase deficient mutant (K55M) of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
JNK2 (MAPK9) Rabbit Polyclonal Antibody
TA327027

USD 374.00

3 Weeks

Rabbit anti-JNK2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen C term -peptide of human JNK2
JNK2 (MAPK9) Rabbit Polyclonal Antibody
TA344631

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL
MAPK9 Human shRNA Plasmid Kit (Locus ID 5601)
TL320486

USD 815.00

2 Weeks

MAPK9 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
MAPK9 Human shRNA Plasmid Kit (Locus ID 5601)
TR320486

USD 715.00

In Stock

MAPK9 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate
LY400972

USD 396.00

5 Days

Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JNK2 (MAPK9) (NM_139068) Human Tagged ORF Clone
RC207608L2

USD 620.00

6 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
JNK2 (MAPK9) (NM_139070) Human Tagged ORF Clone
RC212273L2

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
JNK2 (MAPK9) (NM_002752) Human Tagged ORF Clone
RC212814L2

USD 620.00

3 Weeks

Lenti ORF clone of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MAPK9 Human shRNA Plasmid Kit (Locus ID 5601)
TF320486

USD 715.00

In Stock

MAPK9 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
JNK2 (MAPK9) (NM_139069) Human Recombinant Protein
TP761541

USD 215.00

In Stock

Purified recombinant protein of Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate
LC400972

USD 121.00

In Stock

MAPK9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
JNK2 (MAPK9) (NM_139068) Human Over-expression Lysate
LC408411

USD 121.00

In Stock

MAPK9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Mapk9 (NM_207692) Mouse Untagged Clone
MC204554

USD 210.00

In Stock

Mapk9 (untagged) - Mouse mitogen-activated protein kinase 9 (Mapk9), transcript variant alpha2, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
JNK2 (MAPK9) (NM_139069) Human Untagged Clone
SC124347

USD 530.00

In Stock

MAPK9 (untagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
JNK2 (MAPK9) (NM_139068) Human Untagged Clone
SC321750

USD 760.00

In Stock

MAPK9 (untagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
JNK2 (MAPK9) Rabbit Polyclonal Antibody
AP20523PU-N

USD 370.00

2 Weeks

JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Mapk9 Mouse Gene Knockout Kit (CRISPR)
KN309772BN

USD 1,290.00

4 Weeks

Mapk9 - mouse gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 mBFP-Neo donor, 1 scramble control
Donor DNA mBFP-Neo
JNK2 (MAPK9) (NM_139068) Human Over-expression Lysate
LY408411

USD 396.00

5 Days

Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-a1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JNK2 (MAPK9) (NM_139070) Human Over-expression Lysate
LY408413

USD 605.00

5 Days

Transient overexpression lysate of mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JNK2 (MAPK9) (NM_139070) Human Untagged Clone
SC313403

USD 720.00

2 Weeks

MAPK9 (untagged)-Human mitogen-activated protein kinase 9 (MAPK9), transcript variant JNK2-b2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
MAPK9 / JNK2 (1-382, His-tag) Human Protein
AR50473PU-N

USD 845.00

2 Weeks

MAPK9 / JNK2 (1-382, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
MAPK9 / JNK2 (1-382, His-tag) Human Protein
AR50473PU-S

USD 330.00

2 Weeks

MAPK9 / JNK2 (1-382, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
JNK2 (MAPK9) Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF505869

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
JNK2 (MAPK9) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF505877

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated