Germany
Japan
United Kingdom
China
NPTN (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human NPTN |
Products
View as table Download
NPTN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of neuroplastin (NPTN), transcript variant a
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NPTN (untagged)-Human neuroplastin (NPTN), transcript variant a
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC322063 is the updated version of SC114116.
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN |
Rabbit polyclonal anti-NPTN antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPTN. |
Rabbit Polyclonal Anti-NPTN Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPTN / SDR1 antibody was raised against synthetic 19 amino acid peptide from internal region of human NPTN. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Opossum, Turkey, Zebra finch, Chicken, Platypus, Lizard (89%); Salmon, Stickleback, Pufferfish (84%). |
Rabbit Polyclonal Anti-NPTN Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NPTN / SDR1 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NPTN. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rabbit (100%); Rat, Panda, Opossum (94%); Mouse, Bat, Dog, Bovine, Elephant, Pig (88%); Horse (81%). |
Rabbit Polyclonal Anti-NPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK |
NPTN CRISPRa kit - CRISPR gene activation of human neuroplastin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Nptn CRISPRa kit - CRISPR gene activation of mouse neuroplastin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene NPTN
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene NPTN
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene NPTN
NPTN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NPTN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of neuroplastin (NPTN), transcript variant d
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of neuroplastin (NPTN), transcript variant c
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Nptn (untagged) - Mouse neuroplastin (Nptn), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Nptn (untagged) - Mouse neuroplastin (Nptn), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Nptn
NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NPTN (untagged)-Human neuroplastin (NPTN), transcript variant b
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
3`UTR clone of neuroplastin (NPTN) transcript variant d for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of neuroplastin (NPTN) transcript variant a for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of neuroplastin (NPTN) transcript variant c for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of neuroplastin (NPTN) transcript variant b for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
NPTN (untagged)-Human neuroplastin (NPTN) transcript variant d
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NPTN (untagged)-Human neuroplastin (NPTN) transcript variant c
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NPTN (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR323818 is the updated version of SR308935.
NPTN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-200 of human NPTN (NP_059429.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NPTN