Germany
Japan
United Kingdom
China
Lenti ORF clone of Pde1a (Myc-DDK-tagged ORF) - Rat phosphodiesterase 1A, calmodulin-dependent (Pde1a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Products
View as table DownloadLenti ORF particles, Pde1a (Myc-DDK-tagged ORF) - Rat phosphodiesterase 1A, calmodulin-dependent (Pde1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pde1a (mGFP-tagged ORF) - Rat phosphodiesterase 1A, calmodulin-dependent (Pde1a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pde1a (GFP-tagged ORF) - Rat phosphodiesterase 1A, calmodulin-dependent (Pde1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of PDE1A (mGFP-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PDE1A (untagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Anti-PDE1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLHKNSEDLVNAE, from the C Terminus of the protein sequence according to NP_005010.2. |
PDE1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-PDE1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDE1A CRISPRa kit - CRISPR gene activation of human phosphodiesterase 1A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pde1a CRISPRa kit - CRISPR gene activation of mouse phosphodiesterase 1A, calmodulin-dependent
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PDE1A
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Pde1a (untagged) - Mouse phosphodiesterase 1A, calmodulin-dependent (Pde1a), transcript variant 7, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pde1a (untagged) - Mouse phosphodiesterase 1A, calmodulin-dependent (Pde1a), transcript variant 9, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pde1a (untagged) - Mouse phosphodiesterase 1A, calmodulin-dependent (Pde1a), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pde1a (untagged) - Mouse phosphodiesterase 1A, calmodulin-dependent (Pde1a), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Pde1a
PDE1A MS Standard C13 and N15-labeled recombinant protein (NP_005010)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Pde1a (untagged ORF) - Rat phosphodiesterase 1A, calmodulin-dependent (Pde1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of phosphodiesterase 1A calmodulin-dependent (PDE1A) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of phosphodiesterase 1A calmodulin-dependent (PDE1A) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PDE1A (untagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PDE1A (untagged) - Homo sapiens phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
PDE1A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pde1a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pde1a (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PDE1A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A |
PDE1A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 446-545 of human PDE1A (NP_005010.2). |
| Modifications | Unmodified |
PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDE1A mouse monoclonal antibody,clone 5C9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PDE1A mouse monoclonal antibody,clone 5C9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PDE1A mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PDE1A mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PDE1A