Germany
Japan
United Kingdom
China
USD 820.00
3 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadUSD 820.00
6 Weeks
Lenti ORF particles, ABCD3 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ABCD3 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCD3 (GFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCD3 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,000.00
6 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,000.00
6 Weeks
Lenti ORF particles, ABCD3 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, ABCD3 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, ABCD3 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABCD3 (GFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit anti-ABCD3 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from human ABCD3. |
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ABCD3 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ABCD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD |
Goat Anti-ABCD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1. |
ABCD3 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of ABCD3 (NM_002858) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ABCD3 (NM_001122674) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3), transcript variant 1, Ile440-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of ABCD3 (NM_002858) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCD3 (NM_002858) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ABCD3 (NM_001122674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ABCD3 (NM_001122674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ABCD3
Pathways
- ABC transporters