Products

cDNA Clones (29)
Proteins (23)
Antibodies (3)
Jump to Filters
View as table Download
Acid Phosphatase (ACP1) (NM_001040649) Human Tagged ORF Clone
RC212157

USD 420.00

In Stock

ACP1 (Myc-DDK-tagged)-Human acid phosphatase 1, soluble (ACP1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acid Phosphatase (ACP1) (NM_004300) Human Tagged ORF Clone
RG212653

USD 460.00

In Stock

ACP1 (GFP-tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acid Phosphatase (ACP1) (NM_007099) Human Tagged ORF Clone
RG201078

USD 460.00

In Stock

ACP1 (GFP-tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acid Phosphatase (ACP1) (NM_007099) Human Tagged ORF Clone Lentiviral Particle
RC201078L3V

USD 820.00

7 Weeks

Lenti ORF particles, ACP1 (Myc-DDK tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_007099) Human Tagged ORF Clone
RC201078L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acid phosphatase 1, soluble (ACP1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_007099) Human Tagged ORF Clone Lentiviral Particle
RC201078L4V

USD 820.00

5 Weeks

Lenti ORF particles, ACP1 (mGFP-tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_001040649) Human Tagged ORF Clone Lentiviral Particle
RC212157L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACP1 (Myc-DDK-tagged)-Human acid phosphatase 1, soluble (ACP1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_001040649) Human Tagged ORF Clone Lentiviral Particle
RC212157L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACP1 (mGFP-tagged)-Human acid phosphatase 1, soluble (ACP1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_004300) Human Tagged ORF Clone Lentiviral Particle
RC212653L3V

USD 820.00

5 Weeks

Lenti ORF particles, ACP1 (Myc-DDK tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_004300) Human Tagged ORF Clone Lentiviral Particle
RC212653L4V

USD 820.00

3 Weeks

Lenti ORF particles, ACP1 (mGFP-tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acid Phosphatase (ACP1) (NM_001040649) Human Tagged ORF Clone
RG212157

USD 460.00

3 Weeks

ACP1 (GFP-tagged) - Human acid phosphatase 1, soluble (ACP1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acid Phosphatase (ACP1) Rabbit Polyclonal Antibody
TA346376

USD 410.00

5 Days

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP
Acid Phosphatase (ACP1) (N-term) Rabbit Polyclonal Antibody
AP50056PU-N

USD 450.00

2 Weeks

Acid Phosphatase (ACP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 33~61 amino acids from the N-terminal region of human ACP1
Acid Phosphatase (ACP1) (NM_004300) Human Untagged Clone
SC111923

USD 420.00

In Stock

ACP1 (untagged)-Human acid phosphatase 1, soluble (ACP1), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC111923 is the updated version of SC127966.
ACP1 / LMW-PTPase (1-158, His-tag) Human Protein
AR09161PU-L

USD 1,105.00

2 Weeks

ACP1 / LMW-PTPase (1-158, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ACP1 / LMW-PTPase (1-158, His-tag) Human Protein
AR09161PU-N

USD 415.00

2 Weeks

ACP1 / LMW-PTPase (1-158, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Acid Phosphatase (ACP1) (NM_007099) Human Untagged Clone
SC324456

USD 420.00

In Stock

ACP1 (untagged)-Human acid phosphatase 1, soluble (ACP1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC324456 is the updated version of SC126700.
Acid Phosphatase (ACP1) Rabbit Polyclonal Antibody
TA346451

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA
Acid Phosphatase (ACP1) (NM_004300) Human Tagged ORF Clone
RC212653L2

USD 620.00

3 Weeks

Lenti ORF clone of Human acid phosphatase 1, soluble (ACP1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Acid Phosphatase (ACP1) (BC020699) Human Untagged Clone
SC123582

USD 660.00

In Stock

(untagged)-Homo sapiens, Similar to acid phosphatase 1, soluble, clone MGC:22453 IMAGE:4703064, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Acid Phosphatase (ACP1) (NM_007099) Human Over-expression Lysate
LY402090

USD 396.00

5 Days

Transient overexpression lysate of acid phosphatase 1, soluble (ACP1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Acid Phosphatase (ACP1) (NM_001040649) Human Untagged Clone
SC311204

USD 420.00

2 Weeks

ACP1 (untagged)-Human acid phosphatase 1, soluble (ACP1), transcript variant 4

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Acid Phosphatase (ACP1) (NM_007099) Human Over-expression Lysate
LC402090

USD 121.00

2 Weeks

ACP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Acid Phosphatase (ACP1) (NM_004300) Human Over-expression Lysate
LC418090

USD 121.00

2 Weeks

ACP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Acid Phosphatase (ACP1) (NM_004300) Human Over-expression Lysate
LY418090

USD 396.00

5 Days

Transient overexpression lysate of acid phosphatase 1, soluble (ACP1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Acid Phosphatase (ACP1) (NM_007099) Human Mass Spec Standard
PH301078

USD 2,055.00

3 Weeks

ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_009030)

Tag C-Myc/DDK
Expression Host HEK293
Acid Phosphatase (ACP1) (NM_004300) Human Mass Spec Standard
PH312653

USD 2,055.00

3 Weeks

ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_004291)

Tag C-Myc/DDK
Expression Host HEK293
Acid Phosphatase (ACP1) ICC Control Block
TB401078

USD 1,040.00

4 Weeks

Transient overexpression of ACP1 (NM_007099) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Acid Phosphatase (ACP1) ICC Control Block
TB412157

USD 1,070.00

4 Weeks

Transient overexpression of ACP1 (NM_001040649) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Acid Phosphatase (ACP1) ICC Control Block
TB412653

USD 1,040.00

4 Weeks

Transient overexpression of ACP1 (NM_004300) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein
TP720178

USD 330.00

3 Weeks

Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3

Tag C-His
Expression Host E. coli
Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein
TP720178L

USD 1,900.00

3 Weeks

Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3

Tag C-His
Expression Host E. coli
Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein
TP720178M

USD 760.00

3 Weeks

Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3

Tag C-His
Expression Host E. coli
Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein
TP720178XL

USD 2,800.00

3 Weeks

Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3

Tag C-His
Expression Host E. coli
Acid Phosphatase (ACP1) Cytosection
TS401078

USD 225.00

4 Weeks

Transient overexpression of ACP1 (NM_007099) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack