Products

cDNA Clones (14)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
ACTN3 (NM_001104) Human Tagged ORF Clone
RC211706

USD 420.00

In Stock

ACTN3 (Myc-DDK-tagged)-Human actinin, alpha 3 (ACTN3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACTN3 (NM_001104) Human Tagged ORF Clone
RC211706L3

USD 620.00

3 Weeks

Lenti-ORF clone of ACTN3 (Myc-DDK-tagged)-Human actinin, alpha 3 (ACTN3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACTN3 (NM_001104) Human Tagged ORF Clone
RC211706L4

USD 620.00

3 Weeks

Lenti-ORF clone of ACTN3 (mGFP-tagged)-Human actinin, alpha 3 (ACTN3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACTN3 (NM_001258371) Human Tagged ORF Clone
RC235068

USD 750.00

5 Weeks

ACTN3 (Myc-DDK tagged) - Homo sapiens actinin, alpha 3 (ACTN3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACTN3 (NM_001104) Human Tagged ORF Clone
RG211706

USD 460.00

3 Weeks

ACTN3 (GFP-tagged) - Human actinin, alpha 3 (ACTN3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACTN3 (NM_001258371) Human Tagged ORF Clone
RG235068

USD 830.00

5 Weeks

ACTN3 (GFP-tagged) - Homo sapiens actinin, alpha 3 (ACTN3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACTN3 (N-term) Rabbit Polyclonal Antibody
AP23644PU-N

USD 440.00

2 Weeks

ACTN3 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ACTN3 antibody was raised against synthetic peptide - KLH conjugated
ACTN3 Rabbit Polyclonal Antibody
TA346275

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTN3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY
ACTN3 (NM_001104) Human Tagged ORF Clone
RC211706L2

USD 620.00

3 Weeks

Lenti-ORF clone of ACTN3 (mGFP-tagged)-Human actinin, alpha 3 (ACTN3)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ACTN3 (NM_001104) Human Untagged Clone
SC302972

USD 760.00

In Stock

ACTN3 (untagged)-Human actinin, alpha 3 (ACTN3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ACTN3 Rabbit Polyclonal Antibody
TA313420

USD 345.00

In Stock

Rabbit polyclonal anti-ACTN3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN3.
ACTN3 (Center) Rabbit Polyclonal Antibody
AP50072PU-N

USD 450.00

2 Weeks

ACTN3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 408-437 amino acids from the Central region of human ACTN3
ACTN3 (NM_001104) Human Over-expression Lysate
LC420205

USD 187.00

In Stock

ACTN3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACTN3 (NM_001104) Human Over-expression Lysate
LY420205

USD 605.00

5 Days

Transient overexpression lysate of actinin, alpha 3 (ACTN3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACTN3 (NM_001258371) Human Untagged Clone
SC332676

USD 960.00

5 Weeks

ACTN3 (untagged) - Homo sapiens actinin, alpha 3 (ACTN3), transcript variant 2

Vector pCMV6 series
Tag Tag Free
ACTN3 Rabbit Polyclonal Antibody
TA323240

USD 345.00

In Stock

Anti-ACTN3 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3
ACTN3 Rabbit Polyclonal Antibody
TA323241

USD 345.00

In Stock

Anti-ACTN3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3
ACTN3 ICC Control Block
TB411706

USD 1,070.00

4 Weeks

Transient overexpression of ACTN3 (NM_001104) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACTN3 ICC Control Block
TB435068

USD 1,400.00

4 Weeks

Transient overexpression of ACTN3 (NM_001258371) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACTN3 Cytosection
TS411706

USD 225.00

4 Weeks

Transient overexpression of ACTN3 (NM_001104) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACTN3 Cytosection
TS411706P5

USD 889.00

4 Weeks

Transient overexpression of ACTN3 (NM_001104) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ACTN3 ICC Control Sections
TS435068P5

USD 889.00

4 Weeks

Transient overexpression of ACTN3 (NM_001258371) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack