ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
8 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
8 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,480.00
8 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,480.00
8 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
6 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
6 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
8 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
8 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
8 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,500.00
8 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
8 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
8 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,480.00
8 Weeks
Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,480.00
8 Weeks
Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ATP2A3 (untagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
SERCA3 (ATP2A3) mouse monoclonal antibody, clone 2H3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-ATP2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS |
ATP2A3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ATP2A3 MS Standard C13 and N15-labeled recombinant protein (NP_777613)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ATP2A3 (untagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
ATP2A3 (untagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7
Vector | pCMV6 series |
Tag | Tag Free |