Products

View as table Download

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP2A3 (mGFP-tagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (GFP-tagged) - Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP2A3 (untagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 1

Vector pCMV6 series
Tag Tag Free
SC310014 is the updated version of SC111593.

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS

ATP2A3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 5

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ATP2A3 MS Standard C13 and N15-labeled recombinant protein (NP_777613)

Tag C-Myc/DDK
Expression Host HEK293

ATP2A3 (untagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 2

Vector pCMV6 series
Tag Tag Free

ATP2A3 (untagged)-Human ATPase, Ca++ transporting, ubiquitous (ATP2A3), transcript variant 7

Vector pCMV6 series
Tag Tag Free