Germany
Japan
United Kingdom
China
GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GMPPB (GFP-tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GMPPB (mGFP-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GMPPB (mGFP-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GMPPB (Myc-DDK tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GMPPB (mGFP-tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GMPPB (GFP-tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-GMPPB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GMPPB antibody: synthetic peptide directed towards the C terminal of human GMPPB. Synthetic peptide located within the following region: RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM |
GMPPB (untagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GMPPB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GMPPB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GMPPB MS Standard C13 and N15-labeled recombinant protein (NP_068806)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GMPPB (untagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of GMPPB (NM_021971) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GMPPB (NM_013334) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GMPPB (NM_021971) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GMPPB (NM_021971) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GMPPB (NM_013334) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GMPPB (NM_013334) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GMPPB
Pathways
- Amino sugar and nucleotide sugar metabolism