Germany
Japan
United Kingdom
China
CAPN1 (Myc-DDK-tagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CAPN1 (untagged)-Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, CAPN1 (Myc-DDK tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, CAPN1 (mGFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAPN1 (Myc-DDK tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAPN1 (GFP-tagged) - Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAPN1 (GFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CAPN1 (GFP-tagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CAPN1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CAPN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE |
Transient overexpression lysate of calpain 1, (mu/I) large subunit (CAPN1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Purified recombinant protein of Human calpain 1, (mu/I) large subunit (CAPN1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit polyclonal anti-Calpain 1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 700 of rat Calpain 1 |
Rabbit Polyclonal Anti-CAPN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the N terminal of human CAPN1. Synthetic peptide located within the following region: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL |
CAPN1 (untagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
CAPN1 (untagged) - Homo sapiens calpain 1, (mu/I) large subunit (CAPN1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-CAPN1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Transient overexpression of CAPN1 (NM_005186) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CAPN1 (NM_001198868) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CAPN1 (NM_001198869) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CAPN1 (NM_005186) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CAPN1 (NM_005186) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CAPN1 (NM_001198868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CAPN1 (NM_001198869) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CAPN1
Pathways
- Apoptosis