SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SKP2 (Myc-DDK tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SKP2 (mGFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SKP2 (GFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SKP2 (mGFP-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SKP2 (mGFP-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SKP2 (Myc-DDK tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SKP2 (mGFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SKP2 (Myc-DDK tagged) - Homo sapiens S-phase kinase-associated protein 2, E3 ubiquitin protein ligase (SKP2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SKP2 (GFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SKP2 (GFP-tagged) - Homo sapiens S-phase kinase-associated protein 2, E3 ubiquitin protein ligase (SKP2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SKP2 (untagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-SKP2/p45 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SKP2/p45 Antibody: A synthesized peptide derived from human SKP2/p45 |
SKP2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | synthetic peptide corresponding to a sequence at the N-terminal of human SKP2 |
SKP2 (untagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
SKP2 (p45) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 369-419 of Human Skp2 p45. |
SKP2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit polyclonal SKP2 Antibody (Center)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SKP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human SKP2. |
SKP2 (221-425) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | SKP2 antibody was raised against recombinant protein encoding aa 221-425 of human Skp2 alpha. |
Rabbit Polyclonal anti-SKP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SKP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SKP2. Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL |
SKP2 MS Standard C13 and N15-labeled recombinant protein (NP_005974)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SKP2 (untagged) - Homo sapiens S-phase kinase-associated protein 2, E3 ubiquitin protein ligase (SKP2), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of SKP2 (NM_032637) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SKP2 (NM_005983) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SKP2 (NM_001243120) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SKP2 (NM_032637) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SKP2 (NM_005983) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SKP2 (NM_005983) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SKP2 (NM_001243120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack