Germany
Japan
United Kingdom
China
SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SKP2 (Myc-DDK tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SKP2 (mGFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SKP2 (GFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SKP2 (mGFP-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SKP2 (mGFP-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SKP2 (Myc-DDK tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SKP2 (mGFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SKP2 (Myc-DDK tagged) - Homo sapiens S-phase kinase-associated protein 2, E3 ubiquitin protein ligase (SKP2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SKP2 (GFP-tagged) - Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SKP2 (GFP-tagged) - Homo sapiens S-phase kinase-associated protein 2, E3 ubiquitin protein ligase (SKP2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
SKP2 (untagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-SKP2/p45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SKP2/p45 Antibody: A synthesized peptide derived from human SKP2/p45 |
SKP2 (untagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SKP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal SKP2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SKP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human SKP2. |
Rabbit Polyclonal anti-SKP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SKP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SKP2. Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL |
SKP2 MS Standard C13 and N15-labeled recombinant protein (NP_005974)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SKP2 (untagged) - Homo sapiens S-phase kinase-associated protein 2, E3 ubiquitin protein ligase (SKP2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of SKP2 (NM_032637) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SKP2 (NM_005983) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SKP2 (NM_001243120) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SKP2 (NM_032637) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SKP2 (NM_005983) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SKP2 (NM_005983) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SKP2 (NM_001243120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SKP2
Pathways
- Apoptosis